BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (59 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64621 Uncharacterized protein yhdU n=88 Tax=Enterobact... 121 8e-27 UniRef50_D2TNB8 Predicted membrane protein yhdu n=1 Tax=Citrobac... 89 3e-17 >UniRef50_P64621 Uncharacterized protein yhdU n=88 Tax=Enterobacteriaceae RepID=YHDU_ECO57 Length = 59 Score = 121 bits (303), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 59/59 (100%), Positives = 59/59 (100%) Query: 1 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELNFQDRM 59 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELNFQDRM Sbjct: 1 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELNFQDRM 59 >UniRef50_D2TNB8 Predicted membrane protein yhdu n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TNB8_CITRO Length = 54 Score = 89.4 bits (220), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 41/54 (75%), Positives = 47/54 (87%) Query: 1 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELN 54 MIRKYWWLVVFAV VFLFD LL QW+E + TE+DKCRNM+SVNPL+LVNC +L Sbjct: 1 MIRKYWWLVVFAVTVFLFDALLFQWLETITTESDKCRNMDSVNPLRLVNCADLK 54 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P64621 Uncharacterized protein yhdU n=88 Tax=Enterobact... 89 4e-17 UniRef50_D2TNB8 Predicted membrane protein yhdu n=1 Tax=Citrobac... 82 4e-15 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P64621 Uncharacterized protein yhdU n=88 Tax=Enterobacteriaceae RepID=YHDU_ECO57 Length = 59 Score = 89.2 bits (220), Expect = 4e-17, Method: Composition-based stats. Identities = 59/59 (100%), Positives = 59/59 (100%) Query: 1 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELNFQDRM 59 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELNFQDRM Sbjct: 1 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELNFQDRM 59 >UniRef50_D2TNB8 Predicted membrane protein yhdu n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TNB8_CITRO Length = 54 Score = 82.3 bits (202), Expect = 4e-15, Method: Composition-based stats. Identities = 41/54 (75%), Positives = 47/54 (87%) Query: 1 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDELN 54 MIRKYWWLVVFAV VFLFD LL QW+E + TE+DKCRNM+SVNPL+LVNC +L Sbjct: 1 MIRKYWWLVVFAVTVFLFDALLFQWLETITTESDKCRNMDSVNPLRLVNCADLK 54 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.332 0.149 0.508 Lambda K H 0.267 0.0444 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 271,594,462 Number of Sequences: 3077464 Number of extensions: 8448784 Number of successful extensions: 40192 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 40188 Number of HSP's gapped (non-prelim): 4 length of query: 59 length of database: 1,040,396,356 effective HSP length: 32 effective length of query: 27 effective length of database: 941,917,508 effective search space: 25431772716 effective search space used: 25431772716 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.4 bits) S2: 87 (38.0 bits)