BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (66 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobac... 108 5e-23 UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfa... 41 0.013 >UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobacteriaceae RepID=YEET_ECO57 Length = 73 Score = 108 bits (271), Expect = 5e-23, Method: Composition-based stats. Identities = 37/60 (61%), Positives = 49/60 (81%) Query: 1 MRIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPDITGVLAVYAERRRTA 60 M+II++ AM I++QHP SR+F +CTGKY+WHGS YTGR+V DI GVLAV+AERR+ + Sbjct: 1 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS 60 >UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfatibacillum alkenivorans AK-01 RepID=B8FNH6_DESAA Length = 81 Score = 40.7 bits (94), Expect = 0.013, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 7/67 (10%) Query: 1 MRIISKRRAMTIYRQ------HPESRIFRYCTGKYQWHGSVCHYTGRDVPDI-TGVLAVY 53 M+I++K+ A+ + + + +Y +GKY+W G YTG D+ + +LAVY Sbjct: 1 MKIVTKKDAVELASKTILDGKNRAKTPTKYDSGKYKWTGKASDYTGVDIDFVWPELLAVY 60 Query: 54 AERRRTA 60 ERR A Sbjct: 61 VERRSDA 67 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobac... 111 8e-24 Sequences not found previously or not previously below threshold: UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfa... 42 0.005 CONVERGED! >UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobacteriaceae RepID=YEET_ECO57 Length = 73 Score = 111 bits (277), Expect = 8e-24, Method: Composition-based stats. Identities = 37/60 (61%), Positives = 49/60 (81%) Query: 1 MRIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPDITGVLAVYAERRRTA 60 M+II++ AM I++QHP SR+F +CTGKY+WHGS YTGR+V DI GVLAV+AERR+ + Sbjct: 1 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS 60 >UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfatibacillum alkenivorans AK-01 RepID=B8FNH6_DESAA Length = 81 Score = 42.3 bits (98), Expect = 0.005, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 7/67 (10%) Query: 1 MRIISKRRAMTIYRQ------HPESRIFRYCTGKYQWHGSVCHYTGRDVPDI-TGVLAVY 53 M+I++K+ A+ + + + +Y +GKY+W G YTG D+ + +LAVY Sbjct: 1 MKIVTKKDAVELASKTILDGKNRAKTPTKYDSGKYKWTGKASDYTGVDIDFVWPELLAVY 60 Query: 54 AERRRTA 60 ERR A Sbjct: 61 VERRSDA 67 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.318 0.142 0.427 Lambda K H 0.267 0.0434 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 274,994,266 Number of Sequences: 3077464 Number of extensions: 9012474 Number of successful extensions: 26532 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 26528 Number of HSP's gapped (non-prelim): 4 length of query: 66 length of database: 1,040,396,356 effective HSP length: 38 effective length of query: 28 effective length of database: 923,452,724 effective search space: 25856676272 effective search space used: 25856676272 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 87 (38.0 bits)