/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/8324eda0d41b0d24/hh.c1aqjB_.model.1.pdb
MSNKYCQALVELRNKPAHELKEVGDQWRTPDNIFWGINTLFGPFVLDLFTDGDNAKCAAYYTAEDNALAHDWSERLAELKGAAFGNPPYPW
CCCHHHHHHHHHHHCCCCCCHHHCCCCCCHHHHHHHHHHHHCCCEECCCCCCCCCCHHHHCCHHHHHHHCCHHHHHHHCCCEEECCCCCCC
----------------------------------------++-+++++++++++++++++---++++++++++++----++++++++++--  HHscore 0.486, sequence id 24%  /bmm/www/servers/phyre2/public_html/phyre2_output/8324eda0d41b0d24/hh.c1aqjB_.model.1.pdb

0% of protein confidently modelled...
50% or less of protein confidently modelled - using mergeFragments.py
Post-synthesis iterations: 136400
Protein length: 91  of which strand: 5
Estimated time per simulation: 12 minutes
Number of repetitions of folding: 500
Estimated total CPU time: 104 hours
Estimated wallclock time on 100 processors: 1 hours