BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (82 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_C9XWS7 Uncharacterized protein ybdJ n=5 Tax=Enterobacte... 113 2e-24 UniRef50_Q48414 Uncharacterized protein in ramA 3'region n=103 T... 106 2e-22 UniRef50_UPI0001912BCD hypothetical protein Salmonellaentericaen... 56 4e-07 >UniRef50_C9XWS7 Uncharacterized protein ybdJ n=5 Tax=Enterobacteriaceae RepID=C9XWS7_CROTZ Length = 83 Score = 113 bits (282), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 61/80 (76%), Positives = 74/80 (92%) Query: 1 MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL 60 MKHPLETL TA GILL+AFLSCLLLPAP L L LAQ L++MFHL+DL+QLYT++FC+WFL Sbjct: 1 MKHPLETLITAGGILLLAFLSCLLLPAPRLTLTLAQHLMSMFHLVDLNQLYTIIFCIWFL 60 Query: 61 VLGAIEYFVLRFIWRRWFSL 80 +LGA+EY+V+RF+WRRWFSL Sbjct: 61 LLGAVEYYVIRFVWRRWFSL 80 >UniRef50_Q48414 Uncharacterized protein in ramA 3'region n=103 Tax=Enterobacteriaceae RepID=YBDJ_KLEPN Length = 82 Score = 106 bits (264), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 65/81 (80%), Positives = 73/81 (90%) Query: 1 MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL 60 MKHPLETL +AAGILL+A LSCLLLPAP+LGL LAQKLV FH+MDL+QLYT+LFCLWFL Sbjct: 1 MKHPLETLLSAAGILLLALLSCLLLPAPSLGLTLAQKLVETFHMMDLNQLYTVLFCLWFL 60 Query: 61 VLGAIEYFVLRFIWRRWFSLA 81 LGAIEY VLR++WRRWFSL Sbjct: 61 ALGAIEYLVLRWVWRRWFSLE 81 >UniRef50_UPI0001912BCD hypothetical protein Salmonellaentericaenterica_24729 n=1 Tax=Salmonella enterica subsp. enterica serovar Typhi str. AG3 RepID=UPI0001912BCD Length = 72 Score = 55.8 bits (133), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 26/31 (83%), Positives = 30/31 (96%) Query: 25 LPAPALGLALAQKLVTMFHLMDLSQLYTLLF 55 +PAP+LGLALAQKLV +FHLMDL+QLYTLLF Sbjct: 1 MPAPSLGLALAQKLVGIFHLMDLNQLYTLLF 31 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_C9XWS7 Uncharacterized protein ybdJ n=5 Tax=Enterobacte... 97 2e-19 UniRef50_Q48414 Uncharacterized protein in ramA 3'region n=103 T... 86 3e-16 Sequences not found previously or not previously below threshold: UniRef50_UPI0001912BCD hypothetical protein Salmonellaentericaen... 41 0.014 CONVERGED! >UniRef50_C9XWS7 Uncharacterized protein ybdJ n=5 Tax=Enterobacteriaceae RepID=C9XWS7_CROTZ Length = 83 Score = 96.8 bits (240), Expect = 2e-19, Method: Composition-based stats. Identities = 61/81 (75%), Positives = 74/81 (91%) Query: 1 MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL 60 MKHPLETL TA GILL+AFLSCLLLPAP L L LAQ L++MFHL+DL+QLYT++FC+WFL Sbjct: 1 MKHPLETLITAGGILLLAFLSCLLLPAPRLTLTLAQHLMSMFHLVDLNQLYTIIFCIWFL 60 Query: 61 VLGAIEYFVLRFIWRRWFSLA 81 +LGA+EY+V+RF+WRRWFSL Sbjct: 61 LLGAVEYYVIRFVWRRWFSLE 81 >UniRef50_Q48414 Uncharacterized protein in ramA 3'region n=103 Tax=Enterobacteriaceae RepID=YBDJ_KLEPN Length = 82 Score = 86.1 bits (212), Expect = 3e-16, Method: Composition-based stats. Identities = 65/81 (80%), Positives = 73/81 (90%) Query: 1 MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL 60 MKHPLETL +AAGILL+A LSCLLLPAP+LGL LAQKLV FH+MDL+QLYT+LFCLWFL Sbjct: 1 MKHPLETLLSAAGILLLALLSCLLLPAPSLGLTLAQKLVETFHMMDLNQLYTVLFCLWFL 60 Query: 61 VLGAIEYFVLRFIWRRWFSLA 81 LGAIEY VLR++WRRWFSL Sbjct: 61 ALGAIEYLVLRWVWRRWFSLE 81 >UniRef50_UPI0001912BCD hypothetical protein Salmonellaentericaenterica_24729 n=1 Tax=Salmonella enterica subsp. enterica serovar Typhi str. AG3 RepID=UPI0001912BCD Length = 72 Score = 40.6 bits (94), Expect = 0.014, Method: Composition-based stats. Identities = 26/31 (83%), Positives = 30/31 (96%) Query: 25 LPAPALGLALAQKLVTMFHLMDLSQLYTLLF 55 +PAP+LGLALAQKLV +FHLMDL+QLYTLLF Sbjct: 1 MPAPSLGLALAQKLVGIFHLMDLNQLYTLLF 31 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.332 0.155 0.522 Lambda K H 0.267 0.0464 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 374,563,117 Number of Sequences: 3077464 Number of extensions: 13663125 Number of successful extensions: 72956 Number of sequences better than 1.0e-01: 5 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 72949 Number of HSP's gapped (non-prelim): 9 length of query: 82 length of database: 1,040,396,356 effective HSP length: 53 effective length of query: 29 effective length of database: 877,290,764 effective search space: 25441432156 effective search space used: 25441432156 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.4 bits) S2: 87 (37.9 bits)