BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (35 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_A7ZNU4 UPF0387 membrane protein yohO n=41 Tax=Enterobac... 64 1e-09 UniRef50_A7MHL0 Putative uncharacterized protein n=5 Tax=Enterob... 41 0.010 UniRef50_C6DDY0 Putative uncharacterized protein n=2 Tax=Pectoba... 39 0.056 >UniRef50_A7ZNU4 UPF0387 membrane protein yohO n=41 Tax=Enterobacteriaceae RepID=YOHO_ECO24 Length = 35 Score = 64.3 bits (155), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 35/35 (100%), Positives = 35/35 (100%) Query: 1 MRIAKIGVIALFLFMALGGIGGVMLAGYTFILRAG 35 MRIAKIGVIALFLFMALGGIGGVMLAGYTFILRAG Sbjct: 1 MRIAKIGVIALFLFMALGGIGGVMLAGYTFILRAG 35 >UniRef50_A7MHL0 Putative uncharacterized protein n=5 Tax=Enterobacteriaceae RepID=A7MHL0_ENTS8 Length = 36 Score = 41.2 bits (95), Expect = 0.010, Method: Compositional matrix adjust. Identities = 21/35 (60%), Positives = 27/35 (77%) Query: 1 MRIAKIGVIALFLFMALGGIGGVMLAGYTFILRAG 35 M+ +IG+I + MA+GGIGGVMLAGYT IL +G Sbjct: 1 MKFVRIGLITGMVLMAIGGIGGVMLAGYTVILHSG 35 >UniRef50_C6DDY0 Putative uncharacterized protein n=2 Tax=Pectobacterium RepID=C6DDY0_PECCP Length = 35 Score = 38.9 bits (89), Expect = 0.056, Method: Compositional matrix adjust. Identities = 20/35 (57%), Positives = 25/35 (71%) Query: 1 MRIAKIGVIALFLFMALGGIGGVMLAGYTFILRAG 35 M + KIG+I LF F+ALGG+ G+ML GY I AG Sbjct: 1 MTLQKIGIIGLFAFLALGGMSGMMLVGYIIIEHAG 35 Searching..................................................done ***** No hits found ****** Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.340 0.157 0.458 Lambda K H 0.267 0.0505 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 171,301,883 Number of Sequences: 3077464 Number of extensions: 4809111 Number of successful extensions: 42370 Number of sequences better than 1.0e-01: 5 Number of HSP's better than 0.1 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 42361 Number of HSP's gapped (non-prelim): 9 length of query: 35 length of database: 1,040,396,356 effective HSP length: 9 effective length of query: 26 effective length of database: 1,012,699,180 effective search space: 26330178680 effective search space used: 26330178680 T: 11 A: 40 X1: 16 ( 7.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 88 (38.2 bits)