BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (57 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64454 Uncharacterized protein ydcX n=130 Tax=Enterobac... 113 2e-24 UniRef50_C9Y560 Uncharacterized protein ydcX n=6 Tax=Enterobacte... 86 4e-16 UniRef50_C4X918 Putative uncharacterized protein n=5 Tax=Klebsie... 77 2e-13 UniRef50_B4EZ06 Putative membrane protein n=3 Tax=Enterobacteria... 53 4e-06 UniRef50_A8GFE6 Putative uncharacterized protein n=2 Tax=Serrati... 51 9e-06 UniRef50_A1JLX1 Putative membrane protein n=1 Tax=Yersinia enter... 45 7e-04 UniRef50_C6C3M0 Putative uncharacterized protein n=8 Tax=Enterob... 45 8e-04 UniRef50_C5BE08 Putative uncharacterized protein n=3 Tax=Enterob... 44 0.002 >UniRef50_P64454 Uncharacterized protein ydcX n=130 Tax=Enterobacteriaceae RepID=YDCX_ECOL6 Length = 57 Score = 113 bits (282), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 57/57 (100%), Positives = 57/57 (100%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF Sbjct: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 >UniRef50_C9Y560 Uncharacterized protein ydcX n=6 Tax=Enterobacteriaceae RepID=C9Y560_CROTZ Length = 57 Score = 85.9 bits (211), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 41/57 (71%), Positives = 49/57 (85%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 M+LYQHMLVFYAVMA+IA LIT+F++ DK I+ L A L+GATWPMSFPVALL +LF Sbjct: 1 MTLYQHMLVFYAVMASIAALITFFIAKDKTSIKLLCATLIGATWPMSFPVALLVALF 57 >UniRef50_C4X918 Putative uncharacterized protein n=5 Tax=Klebsiella RepID=C4X918_KLEPN Length = 75 Score = 77.0 bits (188), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 35/57 (61%), Positives = 45/57 (78%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 M+LYQ MLVFYA+M I +I+WFL+ + + IR L+A L+GATWP SFP+ALL SLF Sbjct: 19 MTLYQKMLVFYAIMGVICAVISWFLTKESRMIRLLAALLIGATWPFSFPMALLVSLF 75 >UniRef50_B4EZ06 Putative membrane protein n=3 Tax=Enterobacteriaceae RepID=B4EZ06_PROMH Length = 59 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKK-RIRFLSAFLVGATWPMSFPVALLFSLF 57 MS+ + + Y + A ++F+IT+FL+ D +R LSAFL+ TWP+SFP+A++FS+F Sbjct: 1 MSVIAIIGIGYLIGAVLSFIITFFLTKDPSLAMRLLSAFLIAITWPLSFPMAIIFSIF 58 >UniRef50_A8GFE6 Putative uncharacterized protein n=2 Tax=Serratia RepID=A8GFE6_SERP5 Length = 58 Score = 51.2 bits (121), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 22/48 (45%), Positives = 33/48 (68%) Query: 10 FYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 FY + ++ + T+ +S D +IRF+SA +G TWP+S PV L+FSLF Sbjct: 11 FYLIGLLVSMIFTYLVSRDTIKIRFISALTIGLTWPLSLPVVLMFSLF 58 >UniRef50_A1JLX1 Putative membrane protein n=1 Tax=Yersinia enterocolitica subsp. enterocolitica 8081 RepID=A1JLX1_YERE8 Length = 58 Score = 45.1 bits (105), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Query: 7 MLVFYAVMAAIAFLITWFLSHDKKRI-RFLSAFLVGATWPMSFPVALLFSLF 57 +L Y V I+ I + L+ D+ + R LS+ L+G TWP+S PVALL S+F Sbjct: 7 LLCIYVVGVIISTFIIFPLTRDQSLVVRCLSSLLIGITWPLSLPVALLLSMF 58 >UniRef50_C6C3M0 Putative uncharacterized protein n=8 Tax=Enterobacteriaceae RepID=C6C3M0_DICDC Length = 61 Score = 45.1 bits (105), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Query: 3 LYQHMLVFYAVMAAIAFLITWFLSHDKKR-IRFLSAFLVGATWPMSFPVALLFSLF 57 +++ + + Y + IA L T+F+S D+ IRFL++ L+ TWP+SFPV ++FS F Sbjct: 6 MWETIKLIYLIGFCIAILFTFFMSKDRSLLIRFLASALIALTWPLSFPVVIVFSFF 61 >UniRef50_C5BE08 Putative uncharacterized protein n=3 Tax=Enterobacteriaceae RepID=C5BE08_EDWI9 Length = 61 Score = 43.5 bits (101), Expect = 0.002, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Query: 11 YAVMAAIAFLITWFLSHDKK-RIRFLSAFLVGATWPMSFPVALLFSLF 57 Y + +T+F + D +IR LSA +VG TWPMSFP+ LLF LF Sbjct: 13 YGIGVLFCAFVTFFATKDPSMKIRLLSAIMVGLTWPMSFPLVLLFWLF 60 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_C4X918 Putative uncharacterized protein n=5 Tax=Klebsie... 62 7e-09 UniRef50_P64454 Uncharacterized protein ydcX n=130 Tax=Enterobac... 50 2e-05 UniRef50_C9Y560 Uncharacterized protein ydcX n=6 Tax=Enterobacte... 48 1e-04 Sequences not found previously or not previously below threshold: UniRef50_C5BE08 Putative uncharacterized protein n=3 Tax=Enterob... 41 0.009 UniRef50_B4EZ06 Putative membrane protein n=3 Tax=Enterobacteria... 41 0.016 UniRef50_A8GFE6 Putative uncharacterized protein n=2 Tax=Serrati... 41 0.016 UniRef50_C6C3M0 Putative uncharacterized protein n=8 Tax=Enterob... 39 0.031 CONVERGED! >UniRef50_C4X918 Putative uncharacterized protein n=5 Tax=Klebsiella RepID=C4X918_KLEPN Length = 75 Score = 61.8 bits (149), Expect = 7e-09, Method: Composition-based stats. Identities = 35/57 (61%), Positives = 45/57 (78%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 M+LYQ MLVFYA+M I +I+WFL+ + + IR L+A L+GATWP SFP+ALL SLF Sbjct: 19 MTLYQKMLVFYAIMGVICAVISWFLTKESRMIRLLAALLIGATWPFSFPMALLVSLF 75 >UniRef50_P64454 Uncharacterized protein ydcX n=130 Tax=Enterobacteriaceae RepID=YDCX_ECOL6 Length = 57 Score = 50.3 bits (119), Expect = 2e-05, Method: Composition-based stats. Identities = 57/57 (100%), Positives = 57/57 (100%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF Sbjct: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 >UniRef50_C9Y560 Uncharacterized protein ydcX n=6 Tax=Enterobacteriaceae RepID=C9Y560_CROTZ Length = 57 Score = 47.6 bits (112), Expect = 1e-04, Method: Composition-based stats. Identities = 41/57 (71%), Positives = 49/57 (85%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 M+LYQHMLVFYAVMA+IA LIT+F++ DK I+ L A L+GATWPMSFPVALL +LF Sbjct: 1 MTLYQHMLVFYAVMASIAALITFFIAKDKTSIKLLCATLIGATWPMSFPVALLVALF 57 >UniRef50_C5BE08 Putative uncharacterized protein n=3 Tax=Enterobacteriaceae RepID=C5BE08_EDWI9 Length = 61 Score = 41.4 bits (96), Expect = 0.009, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 3 LYQHMLVFYAVMAAIAFLITWFLSHDKK-RIRFLSAFLVGATWPMSFPVALLFSLF 57 ++ + Y + +T+F + D +IR LSA +VG TWPMSFP+ LLF LF Sbjct: 5 IWSFIKTAYGIGVLFCAFVTFFATKDPSMKIRLLSAIMVGLTWPMSFPLVLLFWLF 60 >UniRef50_B4EZ06 Putative membrane protein n=3 Tax=Enterobacteriaceae RepID=B4EZ06_PROMH Length = 59 Score = 40.7 bits (94), Expect = 0.016, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Query: 1 MSLYQHMLVFYAVMAAIAFLITWFLSHDKKR-IRFLSAFLVGATWPMSFPVALLFSLF 57 MS+ + + Y + A ++F+IT+FL+ D +R LSAFL+ TWP+SFP+A++FS+F Sbjct: 1 MSVIAIIGIGYLIGAVLSFIITFFLTKDPSLAMRLLSAFLIAITWPLSFPMAIIFSIF 58 >UniRef50_A8GFE6 Putative uncharacterized protein n=2 Tax=Serratia RepID=A8GFE6_SERP5 Length = 58 Score = 40.7 bits (94), Expect = 0.016, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 2 SLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF 57 SL+ FY + ++ + T+ +S D +IRF+SA +G TWP+S PV L+FSLF Sbjct: 3 SLWVATQYFYLIGLLVSMIFTYLVSRDTIKIRFISALTIGLTWPLSLPVVLMFSLF 58 >UniRef50_C6C3M0 Putative uncharacterized protein n=8 Tax=Enterobacteriaceae RepID=C6C3M0_DICDC Length = 61 Score = 39.5 bits (91), Expect = 0.031, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Query: 3 LYQHMLVFYAVMAAIAFLITWFLSHDKKR-IRFLSAFLVGATWPMSFPVALLFSLF 57 +++ + + Y + IA L T+F+S D+ IRFL++ L+ TWP+SFPV ++FS F Sbjct: 6 MWETIKLIYLIGFCIAILFTFFMSKDRSLLIRFLASALIALTWPLSFPVVIVFSFF 61 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.329 0.150 0.448 Lambda K H 0.267 0.0467 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 217,865,341 Number of Sequences: 3077464 Number of extensions: 6367688 Number of successful extensions: 44576 Number of sequences better than 1.0e-01: 9 Number of HSP's better than 0.1 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 44554 Number of HSP's gapped (non-prelim): 17 length of query: 57 length of database: 1,040,396,356 effective HSP length: 30 effective length of query: 27 effective length of database: 948,072,436 effective search space: 25597955772 effective search space used: 25597955772 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 87 (37.9 bits)