/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/768c7dda5cc92b67/hh.d2p7tc1.model.1.pdb
MSLYQHMLVFYAVMAAIAFLITWFLSHDKKRIRFLSAFLVGATWPMSFPVALLFSLF
CCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
-------------++++++++++++++++----------------------------  HHscore 0.225, sequence id 31%  /bmm/www/servers/phyre2/public_html/phyre2_output/768c7dda5cc92b67/hh.d2p7tc1.model.1.pdb

0% of protein confidently modelled...
50% or less of protein confidently modelled - using mergeFragments.py
Post-synthesis iterations: 122800
Protein length: 57  of which strand: 0
Estimated time per simulation: 4 minutes
Number of repetitions of folding: 500
Estimated total CPU time: 34 hours
Estimated wallclock time on 100 processors: 0 hours