BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (84 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_B1LPL2 Conserved domain protein n=2 Tax=Escherichia col... 79 4e-14 >UniRef50_B1LPL2 Conserved domain protein n=2 Tax=Escherichia coli RepID=B1LPL2_ECOSM Length = 334 Score = 79.0 bits (193), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 42/78 (53%), Positives = 53/78 (67%), Gaps = 10/78 (12%) Query: 1 MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDII 60 M II AT +FN TL+SNQ++ +DA K+K+ +IY KS+DYA + +R I Sbjct: 1 MSGIISSATEFFNNTLHSNQYEIKDASKEKI----------KDIYNKSVDYATMSNRAAI 50 Query: 61 IAKIDLFIQRITHNLWHA 78 IAKIDLFIQRITHNLW A Sbjct: 51 IAKIDLFIQRITHNLWTA 68 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_B1LPL2 Conserved domain protein n=2 Tax=Escherichia col... 102 5e-21 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_B1LPL2 Conserved domain protein n=2 Tax=Escherichia coli RepID=B1LPL2_ECOSM Length = 334 Score = 102 bits (253), Expect = 5e-21, Method: Composition-based stats. Identities = 42/78 (53%), Positives = 53/78 (67%), Gaps = 10/78 (12%) Query: 1 MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDII 60 M II AT +FN TL+SNQ++ +DA K+K+ +IY KS+DYA + +R I Sbjct: 1 MSGIISSATEFFNNTLHSNQYEIKDASKEKI----------KDIYNKSVDYATMSNRAAI 50 Query: 61 IAKIDLFIQRITHNLWHA 78 IAKIDLFIQRITHNLW A Sbjct: 51 IAKIDLFIQRITHNLWTA 68 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.324 0.132 0.369 Lambda K H 0.267 0.0408 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 327,980,657 Number of Sequences: 3077464 Number of extensions: 11026864 Number of successful extensions: 37915 Number of sequences better than 1.0e-01: 1 Number of HSP's better than 0.1 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 37910 Number of HSP's gapped (non-prelim): 3 length of query: 84 length of database: 1,040,396,356 effective HSP length: 54 effective length of query: 30 effective length of database: 874,213,300 effective search space: 26226399000 effective search space used: 26226399000 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.1 bits) S2: 87 (38.1 bits)