/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/707364f4e19605ad/hh.c3k0zB_.model.1.pdb
MRAAFWVGCAALLLSACSSEPVQQATAAHVAPGLKASMSSSGEANCAMIGGSLSVARQLDGTAIGMCALPNGKRCSEQSLAAGSCGSY
CCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCEEEEEECCCCCCEEEEECCCCCEEEHHHHHCCCCCCC
---------------------------------------------------------------++++++++++++++++++-------  HHscore 0.282, sequence id 22%  /bmm/www/servers/phyre2/public_html/phyre2_output/707364f4e19605ad/hh.c3k0zB_.model.1.pdb

0% of protein confidently modelled...
50% or less of protein confidently modelled - using mergeFragments.py
Post-synthesis iterations: 135200
Protein length: 88  of which strand: 14
Estimated time per simulation: 11 minutes
Number of repetitions of folding: 500
Estimated total CPU time: 96 hours
Estimated wallclock time on 100 processors: 0 hours