/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/6d16fa8f18ab8061/hh.d1ocsa_.model.1.pdb
MYKITATIEKEGGTPTNWTRYSKSKLTKSECEKMLSGKKEAGVSREQKVKLINFNCEKLQSSRIALYSN
CEEEEEEEECCCCCCEEEEEEECCCCCHHHHHHHHCCCHHCCEEEEEEEEEEEEEEEECCCEEEEEEEC
-++++++++++++++++++++++++++++++++++++++------------------------------  HHscore 0.272, sequence id 13%  /bmm/www/servers/phyre2/public_html/phyre2_output/6d16fa8f18ab8061/hh.d1ocsa_.model.1.pdb

0% of protein confidently modelled...
50% or less of protein confidently modelled - using mergeFragments.py
Post-synthesis iterations: 127600
Protein length: 69  of which strand: 38
Estimated time per simulation: 6 minutes
Number of repetitions of folding: 500
Estimated total CPU time: 53 hours
Estimated wallclock time on 100 processors: 0 hours