BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (46 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64443 Uncharacterized protein yceO n=85 Tax=Enterobact... 90 2e-17 UniRef50_D2TT64 Putative membrane protein n=1 Tax=Citrobacter ro... 54 1e-06 >UniRef50_P64443 Uncharacterized protein yceO n=85 Tax=Enterobacteriaceae RepID=YCEO_ECO57 Length = 46 Score = 89.7 bits (221), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MRPFLQEYLMRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF 46 MRPFLQEYLMRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF Sbjct: 1 MRPFLQEYLMRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF 46 >UniRef50_D2TT64 Putative membrane protein n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TT64_CITRO Length = 37 Score = 54.3 bits (129), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 23/37 (62%), Positives = 32/37 (86%) Query: 10 MRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF 46 MRRL + +NNIR+H MLY+FLW LLAI+D+IY+++F Sbjct: 1 MRRLFQFWVNNIRQHFMLYIFLWSLLAILDVIYIYFF 37 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P64443 Uncharacterized protein yceO n=85 Tax=Enterobact... 48 1e-04 Sequences not found previously or not previously below threshold: UniRef50_D2TT64 Putative membrane protein n=1 Tax=Citrobacter ro... 39 0.037 CONVERGED! >UniRef50_P64443 Uncharacterized protein yceO n=85 Tax=Enterobacteriaceae RepID=YCEO_ECO57 Length = 46 Score = 47.8 bits (113), Expect = 1e-04, Method: Composition-based stats. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MRPFLQEYLMRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF 46 MRPFLQEYLMRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF Sbjct: 1 MRPFLQEYLMRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF 46 >UniRef50_D2TT64 Putative membrane protein n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TT64_CITRO Length = 37 Score = 39.3 bits (91), Expect = 0.037, Method: Composition-based stats. Identities = 23/37 (62%), Positives = 32/37 (86%) Query: 10 MRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF 46 MRRL + +NNIR+H MLY+FLW LLAI+D+IY+++F Sbjct: 1 MRRLFQFWVNNIRQHFMLYIFLWSLLAILDVIYIYFF 37 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.346 0.168 0.565 Lambda K H 0.267 0.0510 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 236,366,665 Number of Sequences: 3077464 Number of extensions: 7735321 Number of successful extensions: 53535 Number of sequences better than 1.0e-01: 4 Number of HSP's better than 0.1 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 53527 Number of HSP's gapped (non-prelim): 8 length of query: 46 length of database: 1,040,396,356 effective HSP length: 20 effective length of query: 26 effective length of database: 978,847,076 effective search space: 25450023976 effective search space used: 25450023976 T: 11 A: 40 X1: 15 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.6 bits) S2: 88 (38.2 bits)