BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (48 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0ADB9 Entericidin B n=61 Tax=Enterobacteriaceae RepID=... 95 7e-19 UniRef50_C9Y198 Entericidin B n=15 Tax=Enterobacteriaceae RepID=... 85 7e-16 UniRef50_A8G8T2 Entericidin EcnAB n=6 Tax=Enterobacteriaceae Rep... 54 2e-06 UniRef50_D0S831 Predicted protein n=3 Tax=Acinetobacter RepID=D0... 45 6e-04 UniRef50_P0ADB6 Entericidin A n=91 Tax=Enterobacteriaceae RepID=... 45 0.001 UniRef50_Q398U9 Entericidin EcnAB n=38 Tax=Proteobacteria RepID=... 43 0.002 UniRef50_Q6FE13 Bacteriolytic lipoprotein entericidin B n=3 Tax=... 43 0.004 UniRef50_A5VDA6 Entericidin EcnAB n=9 Tax=Proteobacteria RepID=A... 42 0.005 UniRef50_A6T0Y1 Entericidin B n=5 Tax=Proteobacteria RepID=A6T0Y... 42 0.006 UniRef50_B5WFA4 Entericidin EcnAB n=2 Tax=Burkholderia RepID=B5W... 40 0.023 UniRef50_C4LD66 Entericidin EcnAB n=1 Tax=Tolumonas auensis DSM ... 40 0.029 UniRef50_B0VRY4 Bacteriolytic lipoprotein entericidin B n=11 Tax... 39 0.040 UniRef50_C1DD60 Putative uncharacterized protein n=1 Tax=Laribac... 39 0.056 UniRef50_D0CW93 Conserved domain protein n=7 Tax=Proteobacteria ... 39 0.062 UniRef50_C6WVD2 Entericidin EcnAB n=2 Tax=Proteobacteria RepID=C... 38 0.079 >UniRef50_P0ADB9 Entericidin B n=61 Tax=Enterobacteriaceae RepID=ECNB_ECO57 Length = 48 Score = 94.7 bits (234), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 48/48 (100%), Positives = 48/48 (100%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ Sbjct: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 >UniRef50_C9Y198 Entericidin B n=15 Tax=Enterobacteriaceae RepID=C9Y198_CROTZ Length = 48 Score = 85.1 bits (209), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 41/48 (85%), Positives = 45/48 (93%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 MVKKTIAA+FS LVLS++LTACNTTRGVGEDI DGGNAISGAAT+A Q Sbjct: 1 MVKKTIAALFSALVLSSLLTACNTTRGVGEDIQDGGNAISGAATRASQ 48 >UniRef50_A8G8T2 Entericidin EcnAB n=6 Tax=Enterobacteriaceae RepID=A8G8T2_SERP5 Length = 43 Score = 53.9 bits (128), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 27/43 (62%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAA 43 M+KK+I AIFS++ L++ LTACNTT+GVGEDI GG AI +A Sbjct: 1 MLKKSIIAIFSLMFLAS-LTACNTTQGVGEDIQAGGKAIQRSA 42 >UniRef50_D0S831 Predicted protein n=3 Tax=Acinetobacter RepID=D0S831_ACIJO Length = 58 Score = 45.4 bits (106), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 20/39 (51%), Positives = 27/39 (69%) Query: 9 IFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 + S LV+ VLT CNT +G+G+D+S GNA+S A K Q Sbjct: 15 VLSSLVMLFVLTGCNTVKGMGKDVSSAGNAVSHTAEKTQ 53 >UniRef50_P0ADB6 Entericidin A n=91 Tax=Enterobacteriaceae RepID=ECNA_ECO57 Length = 41 Score = 44.7 bits (104), Expect = 0.001, Method: Compositional matrix adjust. Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAAT 44 M+K+ I VL+ ST+LT CNT RG GEDI GN+IS AA+ Sbjct: 1 MMKRLIVL---VLLASTLLTGCNTARGFGEDIKHLGNSISRAAS 41 >UniRef50_Q398U9 Entericidin EcnAB n=38 Tax=Proteobacteria RepID=Q398U9_BURS3 Length = 93 Score = 43.1 bits (100), Expect = 0.002, Method: Compositional matrix adjust. Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 2/44 (4%) Query: 4 KTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 +TIAA+ LV++ L CNT G+G+DIS GG AIS A KA+ Sbjct: 52 RTIAAML--LVVTAALAGCNTVAGMGQDISKGGQAISDTAEKAK 93 >UniRef50_Q6FE13 Bacteriolytic lipoprotein entericidin B n=3 Tax=Proteobacteria RepID=Q6FE13_ACIAD Length = 47 Score = 42.7 bits (99), Expect = 0.004, Method: Compositional matrix adjust. Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 M+KK +AA SV+V + VLT CNT +GVG+D+S G+A++ A K Q Sbjct: 1 MMKKILAA--SVMV-AFVLTGCNTFKGVGKDVSRAGDAVTNTAEKTQN 45 >UniRef50_A5VDA6 Entericidin EcnAB n=9 Tax=Proteobacteria RepID=A5VDA6_SPHWW Length = 75 Score = 42.4 bits (98), Expect = 0.005, Method: Compositional matrix adjust. Identities = 23/43 (53%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAA 43 M K+TIA F L L V TACNT G G+D+S G A+S AA Sbjct: 30 MFKRTIAVAFVSLSLLAV-TACNTVEGAGKDVSSAGRAVSDAA 71 >UniRef50_A6T0Y1 Entericidin B n=5 Tax=Proteobacteria RepID=A6T0Y1_JANMA Length = 44 Score = 42.0 bits (97), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/41 (51%), Positives = 27/41 (65%) Query: 4 KTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAAT 44 K I +I VL +S L+ACNT +GVG+D+ GG I AAT Sbjct: 2 KKIISIACVLAMSIGLSACNTFKGVGQDVQRGGEKIQDAAT 42 >UniRef50_B5WFA4 Entericidin EcnAB n=2 Tax=Burkholderia RepID=B5WFA4_9BURK Length = 45 Score = 40.0 bits (92), Expect = 0.023, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Query: 9 IFSVLVLS---TVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 + ++LVL+ ++T CNT G GEDIS GG+AIS A KA+ Sbjct: 4 LIALLVLAGTAMLVTGCNTIAGAGEDISKGGHAISNEAEKAK 45 >UniRef50_C4LD66 Entericidin EcnAB n=1 Tax=Tolumonas auensis DSM 9187 RepID=C4LD66_TOLAT Length = 45 Score = 39.7 bits (91), Expect = 0.029, Method: Compositional matrix adjust. Identities = 19/40 (47%), Positives = 24/40 (60%) Query: 9 IFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 I +L+ L+ACNT GVG+DI GG + AAT QQ Sbjct: 4 ITGLLIAIFFLSACNTIHGVGQDIQRGGEKVKDAATDVQQ 43 >UniRef50_B0VRY4 Bacteriolytic lipoprotein entericidin B n=11 Tax=Moraxellaceae RepID=B0VRY4_ACIBS Length = 47 Score = 39.3 bits (90), Expect = 0.040, Method: Compositional matrix adjust. Identities = 21/47 (44%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 M+KK + A SV+V + VLT CNT +G G+D+S G+A++ A K + Sbjct: 1 MMKKVLVA--SVMV-AFVLTGCNTLKGFGQDVSKAGDAVTNTAQKTE 44 >UniRef50_C1DD60 Putative uncharacterized protein n=1 Tax=Laribacter hongkongensis HLHK9 RepID=C1DD60_LARHH Length = 45 Score = 38.9 bits (89), Expect = 0.056, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 26/35 (74%) Query: 9 IFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAA 43 + +L+ S +LTACNT G+G+D+S G+A++ AA Sbjct: 4 LIGILLASCLLTACNTMAGMGQDVSSAGHAVTNAA 38 >UniRef50_D0CW93 Conserved domain protein n=7 Tax=Proteobacteria RepID=D0CW93_9RHOB Length = 47 Score = 38.5 bits (88), Expect = 0.062, Method: Compositional matrix adjust. Identities = 17/30 (56%), Positives = 21/30 (70%) Query: 19 LTACNTTRGVGEDISDGGNAISGAATKAQQ 48 LTAC T +G G+DI G+AI GAAT Q+ Sbjct: 16 LTACETAKGAGKDIEKAGDAIQGAATDVQE 45 >UniRef50_C6WVD2 Entericidin EcnAB n=2 Tax=Proteobacteria RepID=C6WVD2_METML Length = 39 Score = 38.1 bits (87), Expect = 0.079, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 25/36 (69%) Query: 9 IFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAAT 44 +F ++++ VL+ACNT G+G+D+ GG AI +A Sbjct: 4 LFFFVMIAAVLSACNTVAGIGKDLEKGGEAIQKSAN 39 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P0ADB9 Entericidin B n=61 Tax=Enterobacteriaceae RepID=... 56 5e-07 UniRef50_C9Y198 Entericidin B n=15 Tax=Enterobacteriaceae RepID=... 54 1e-06 UniRef50_D0S831 Predicted protein n=3 Tax=Acinetobacter RepID=D0... 48 7e-05 UniRef50_A8G8T2 Entericidin EcnAB n=6 Tax=Enterobacteriaceae Rep... 47 3e-04 UniRef50_P0ADB6 Entericidin A n=91 Tax=Enterobacteriaceae RepID=... 46 4e-04 Sequences not found previously or not previously below threshold: UniRef50_A4SQR1 Glucose/sorbosone dehydrogenase family n=1 Tax=A... 41 0.009 UniRef50_Q398U9 Entericidin EcnAB n=38 Tax=Proteobacteria RepID=... 40 0.019 UniRef50_A5VDA6 Entericidin EcnAB n=9 Tax=Proteobacteria RepID=A... 40 0.019 UniRef50_UPI0001826DD8 entericidin EcnAB n=1 Tax=Enterobacter ca... 40 0.033 UniRef50_A7HP47 Entericidin EcnAB n=6 Tax=Proteobacteria RepID=A... 38 0.082 CONVERGED! >UniRef50_P0ADB9 Entericidin B n=61 Tax=Enterobacteriaceae RepID=ECNB_ECO57 Length = 48 Score = 55.5 bits (132), Expect = 5e-07, Method: Composition-based stats. Identities = 48/48 (100%), Positives = 48/48 (100%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ Sbjct: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 >UniRef50_C9Y198 Entericidin B n=15 Tax=Enterobacteriaceae RepID=C9Y198_CROTZ Length = 48 Score = 54.4 bits (129), Expect = 1e-06, Method: Composition-based stats. Identities = 41/48 (85%), Positives = 45/48 (93%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ 48 MVKKTIAA+FS LVLS++LTACNTTRGVGEDI DGGNAISGAAT+A Q Sbjct: 1 MVKKTIAALFSALVLSSLLTACNTTRGVGEDIQDGGNAISGAATRASQ 48 >UniRef50_D0S831 Predicted protein n=3 Tax=Acinetobacter RepID=D0S831_ACIJO Length = 58 Score = 48.2 bits (113), Expect = 7e-05, Method: Composition-based stats. Identities = 20/39 (51%), Positives = 27/39 (69%) Query: 9 IFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 + S LV+ VLT CNT +G+G+D+S GNA+S A K Q Sbjct: 15 VLSSLVMLFVLTGCNTVKGMGKDVSSAGNAVSHTAEKTQ 53 >UniRef50_A8G8T2 Entericidin EcnAB n=6 Tax=Enterobacteriaceae RepID=A8G8T2_SERP5 Length = 43 Score = 46.6 bits (109), Expect = 3e-04, Method: Composition-based stats. Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAAT 44 M+KK+I AIFS++ L++ LTACNTT+GVGEDI GG AI +A Sbjct: 1 MLKKSIIAIFSLMFLAS-LTACNTTQGVGEDIQAGGKAIQRSAE 43 >UniRef50_P0ADB6 Entericidin A n=91 Tax=Enterobacteriaceae RepID=ECNA_ECO57 Length = 41 Score = 45.9 bits (107), Expect = 4e-04, Method: Composition-based stats. Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAAT 44 M+K+ I + L+ ST+LT CNT RG GEDI GN+IS AA+ Sbjct: 1 MMKRLIVLV---LLASTLLTGCNTARGFGEDIKHLGNSISRAAS 41 >UniRef50_A4SQR1 Glucose/sorbosone dehydrogenase family n=1 Tax=Aeromonas salmonicida subsp. salmonicida A449 RepID=A4SQR1_AERS4 Length = 348 Score = 41.3 bits (95), Expect = 0.009, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 20/36 (55%) Query: 10 FSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATK 45 + +L+ +L CNT GVG DI G I +A+K Sbjct: 313 YGLLLCCALLMGCNTVSGVGRDIEKAGEVIQRSASK 348 >UniRef50_Q398U9 Entericidin EcnAB n=38 Tax=Proteobacteria RepID=Q398U9_BURS3 Length = 93 Score = 40.5 bits (93), Expect = 0.019, Method: Composition-based stats. Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 2/46 (4%) Query: 2 VKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 + +TIAA+ LV++ L CNT G+G+DIS GG AIS A KA+ Sbjct: 50 MTRTIAAML--LVVTAALAGCNTVAGMGQDISKGGQAISDTAEKAK 93 >UniRef50_A5VDA6 Entericidin EcnAB n=9 Tax=Proteobacteria RepID=A5VDA6_SPHWW Length = 75 Score = 40.5 bits (93), Expect = 0.019, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 M K+TIA F L L V TACNT G G+D+S G A+S AA ++ Sbjct: 30 MFKRTIAVAFVSLSLLAV-TACNTVEGAGKDVSSAGRAVSDAADDSK 75 >UniRef50_UPI0001826DD8 entericidin EcnAB n=1 Tax=Enterobacter cancerogenus ATCC 35316 RepID=UPI0001826DD8 Length = 59 Score = 39.7 bits (91), Expect = 0.033, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 29/44 (65%) Query: 1 MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAAT 44 M+K+ + + + + S L+ CNT RG+GEDI D G+ IS AA+ Sbjct: 16 MMKRIVKILLLLALSSAFLSGCNTARGMGEDIQDLGHIISHAAS 59 >UniRef50_A7HP47 Entericidin EcnAB n=6 Tax=Proteobacteria RepID=A7HP47_PARL1 Length = 71 Score = 38.2 bits (87), Expect = 0.082, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 25/44 (56%) Query: 4 KTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQ 47 K + A+ ++LV L ACNT G G+DI GG AI A A+ Sbjct: 28 KHVFAMLALLVAGFGLAACNTVEGAGQDIQRGGAAIEDTANDAK 71 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.321 0.129 0.325 Lambda K H 0.267 0.0393 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 130,941,367 Number of Sequences: 3077464 Number of extensions: 2508931 Number of successful extensions: 8896 Number of sequences better than 1.0e-01: 62 Number of HSP's better than 0.1 without gapping: 75 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 8819 Number of HSP's gapped (non-prelim): 83 length of query: 48 length of database: 1,040,396,356 effective HSP length: 21 effective length of query: 27 effective length of database: 975,769,612 effective search space: 26345779524 effective search space used: 26345779524 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.4 bits) S2: 87 (38.2 bits)