BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (92 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P75711 Uncharacterized protein ybbV n=7 Tax=Escherichia... 186 2e-46 UniRef50_D0ZP16 Putative cytoplasmic protein n=2 Tax=Salmonella ... 62 7e-09 >UniRef50_P75711 Uncharacterized protein ybbV n=7 Tax=Escherichia coli RepID=YBBV_ECOLI Length = 92 Score = 186 bits (472), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 92/92 (100%), Positives = 92/92 (100%) Query: 1 MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRDLWNIRENYSSNAAIA 60 MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRDLWNIRENYSSNAAIA Sbjct: 1 MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRDLWNIRENYSSNAAIA 60 Query: 61 KIYCRKRKASGPGKHLTILPYGWVRFITFPIM 92 KIYCRKRKASGPGKHLTILPYGWVRFITFPIM Sbjct: 61 KIYCRKRKASGPGKHLTILPYGWVRFITFPIM 92 >UniRef50_D0ZP16 Putative cytoplasmic protein n=2 Tax=Salmonella enterica subsp. enterica serovar Typhimurium RepID=D0ZP16_SALT1 Length = 84 Score = 61.6 bits (148), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 30/53 (56%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Query: 39 IREIKRDLWNIRENYSSNAAIAKIYCRKRKASGPGKHLTILPYGWVRFITFPI 91 +RE KRDLWNI+E+Y+S+A IAK Y ++K + G+HLTI PYGW +IT I Sbjct: 1 MRE-KRDLWNIKESYTSSAVIAKTYYLRQKPNETGRHLTISPYGWDLYITCQI 52 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P75711 Uncharacterized protein ybbV n=7 Tax=Escherichia... 155 6e-37 UniRef50_D0ZP16 Putative cytoplasmic protein n=2 Tax=Salmonella ... 88 1e-16 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P75711 Uncharacterized protein ybbV n=7 Tax=Escherichia coli RepID=YBBV_ECOLI Length = 92 Score = 155 bits (391), Expect = 6e-37, Method: Composition-based stats. Identities = 92/92 (100%), Positives = 92/92 (100%) Query: 1 MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRDLWNIRENYSSNAAIA 60 MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRDLWNIRENYSSNAAIA Sbjct: 1 MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRDLWNIRENYSSNAAIA 60 Query: 61 KIYCRKRKASGPGKHLTILPYGWVRFITFPIM 92 KIYCRKRKASGPGKHLTILPYGWVRFITFPIM Sbjct: 61 KIYCRKRKASGPGKHLTILPYGWVRFITFPIM 92 >UniRef50_D0ZP16 Putative cytoplasmic protein n=2 Tax=Salmonella enterica subsp. enterica serovar Typhimurium RepID=D0ZP16_SALT1 Length = 84 Score = 87.8 bits (216), Expect = 1e-16, Method: Composition-based stats. Identities = 30/53 (56%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Query: 39 IREIKRDLWNIRENYSSNAAIAKIYCRKRKASGPGKHLTILPYGWVRFITFPI 91 +RE KRDLWNI+E+Y+S+A IAK Y ++K + G+HLTI PYGW +IT I Sbjct: 1 MRE-KRDLWNIKESYTSSAVIAKTYYLRQKPNETGRHLTISPYGWDLYITCQI 52 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.324 0.140 0.409 Lambda K H 0.267 0.0421 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 368,847,610 Number of Sequences: 3077464 Number of extensions: 12039726 Number of successful extensions: 37315 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 37311 Number of HSP's gapped (non-prelim): 4 length of query: 92 length of database: 1,040,396,356 effective HSP length: 62 effective length of query: 30 effective length of database: 849,593,588 effective search space: 25487807640 effective search space used: 25487807640 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 87 (38.1 bits)