BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (62 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q79AM8 Orf62 n=2 Tax=Escherichia coli RepID=Q79AM8_ECOLX 127 9e-29 >UniRef50_Q79AM8 Orf62 n=2 Tax=Escherichia coli RepID=Q79AM8_ECOLX Length = 62 Score = 127 bits (320), Expect = 9e-29, Method: Compositional matrix adjust. Identities = 62/62 (100%), Positives = 62/62 (100%) Query: 1 MEGWRVLNKLANLRIDQNKSGTTAFHAGKFFRFPAFFSDPTVNSLFSHTEAFSQFFGGHF 60 MEGWRVLNKLANLRIDQNKSGTTAFHAGKFFRFPAFFSDPTVNSLFSHTEAFSQFFGGHF Sbjct: 1 MEGWRVLNKLANLRIDQNKSGTTAFHAGKFFRFPAFFSDPTVNSLFSHTEAFSQFFGGHF 60 Query: 61 IA 62 IA Sbjct: 61 IA 62 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q79AM8 Orf62 n=2 Tax=Escherichia coli RepID=Q79AM8_ECOLX 107 1e-22 Sequences not found previously or not previously below threshold: UniRef50_B4RS49 Putative lipopolysaccharide modification acyltra... 38 0.078 CONVERGED! >UniRef50_Q79AM8 Orf62 n=2 Tax=Escherichia coli RepID=Q79AM8_ECOLX Length = 62 Score = 107 bits (267), Expect = 1e-22, Method: Composition-based stats. Identities = 62/62 (100%), Positives = 62/62 (100%) Query: 1 MEGWRVLNKLANLRIDQNKSGTTAFHAGKFFRFPAFFSDPTVNSLFSHTEAFSQFFGGHF 60 MEGWRVLNKLANLRIDQNKSGTTAFHAGKFFRFPAFFSDPTVNSLFSHTEAFSQFFGGHF Sbjct: 1 MEGWRVLNKLANLRIDQNKSGTTAFHAGKFFRFPAFFSDPTVNSLFSHTEAFSQFFGGHF 60 Query: 61 IA 62 IA Sbjct: 61 IA 62 >UniRef50_B4RS49 Putative lipopolysaccharide modification acyltransferase n=1 Tax=Alteromonas macleodii 'Deep ecotype' RepID=B4RS49_ALTMD Length = 639 Score = 38.5 bits (88), Expect = 0.078, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 6/61 (9%) Query: 1 MEGWRVLNKLANLRIDQNKSGTTAFHAGKFFR-FPAFFSDPTVNSLFSHTEAFSQFFGGH 59 + G+ ++ ++ N +I QN + F+ +F R FPAFF+ +V+SLF AFS F G Sbjct: 65 ISGYLIMGQIYN-KIQQNAFSISDFYVKRFKRLFPAFFATVSVSSLF----AFSYFLPGE 119 Query: 60 F 60 F Sbjct: 120 F 120 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.328 0.139 0.442 Lambda K H 0.267 0.0435 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 296,588,652 Number of Sequences: 3077464 Number of extensions: 10095137 Number of successful extensions: 26042 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 26040 Number of HSP's gapped (non-prelim): 3 length of query: 62 length of database: 1,040,396,356 effective HSP length: 34 effective length of query: 28 effective length of database: 935,762,580 effective search space: 26201352240 effective search space used: 26201352240 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 87 (38.0 bits)