BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (86 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q79CP2 Putative uncharacterized protein ygiA n=18 Tax=E... 180 1e-44 UniRef50_UPI000190F518 hypothetical protein SentesTyph_05442 n=1... 56 4e-07 >UniRef50_Q79CP2 Putative uncharacterized protein ygiA n=18 Tax=Enterobacteriaceae RepID=YGIA_ECOLI Length = 86 Score = 180 bits (457), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MTTTGLRPRLNVRQRKDTGYLPHSSPFSLQFRPAILYSDGYLPLVPEDKNETDKIHTPRI 60 MTTTGLRPRLNVRQRKDTGYLPHSSPFSLQFRPAILYSDGYLPLVPEDKNETDKIHTPRI Sbjct: 1 MTTTGLRPRLNVRQRKDTGYLPHSSPFSLQFRPAILYSDGYLPLVPEDKNETDKIHTPRI 60 Query: 61 VPQKLERTPSDTSRSRGCHCFYAGWL 86 VPQKLERTPSDTSRSRGCHCFYAGWL Sbjct: 61 VPQKLERTPSDTSRSRGCHCFYAGWL 86 >UniRef50_UPI000190F518 hypothetical protein SentesTyph_05442 n=1 Tax=Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 RepID=UPI000190F518 Length = 58 Score = 55.8 bits (133), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 26/42 (61%), Positives = 28/42 (66%) Query: 45 VPEDKNETDKIHTPRIVPQKLERTPSDTSRSRGCHCFYAGWL 86 V EDK ETDKIH RI+ QKLER + R G CFYAGWL Sbjct: 17 VLEDKYETDKIHPSRIISQKLERAAFNAGRPGGYGCFYAGWL 58 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q79CP2 Putative uncharacterized protein ygiA n=18 Tax=E... 167 1e-40 UniRef50_UPI000190F518 hypothetical protein SentesTyph_05442 n=1... 88 8e-17 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_Q79CP2 Putative uncharacterized protein ygiA n=18 Tax=Enterobacteriaceae RepID=YGIA_ECOLI Length = 86 Score = 167 bits (422), Expect = 1e-40, Method: Composition-based stats. Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MTTTGLRPRLNVRQRKDTGYLPHSSPFSLQFRPAILYSDGYLPLVPEDKNETDKIHTPRI 60 MTTTGLRPRLNVRQRKDTGYLPHSSPFSLQFRPAILYSDGYLPLVPEDKNETDKIHTPRI Sbjct: 1 MTTTGLRPRLNVRQRKDTGYLPHSSPFSLQFRPAILYSDGYLPLVPEDKNETDKIHTPRI 60 Query: 61 VPQKLERTPSDTSRSRGCHCFYAGWL 86 VPQKLERTPSDTSRSRGCHCFYAGWL Sbjct: 61 VPQKLERTPSDTSRSRGCHCFYAGWL 86 >UniRef50_UPI000190F518 hypothetical protein SentesTyph_05442 n=1 Tax=Salmonella enterica subsp. enterica serovar Typhi str. E98-0664 RepID=UPI000190F518 Length = 58 Score = 88.1 bits (217), Expect = 8e-17, Method: Composition-based stats. Identities = 26/42 (61%), Positives = 28/42 (66%) Query: 45 VPEDKNETDKIHTPRIVPQKLERTPSDTSRSRGCHCFYAGWL 86 V EDK ETDKIH RI+ QKLER + R G CFYAGWL Sbjct: 17 VLEDKYETDKIHPSRIISQKLERAAFNAGRPGGYGCFYAGWL 58 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.317 0.141 0.430 Lambda K H 0.267 0.0432 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 387,821,765 Number of Sequences: 3077464 Number of extensions: 15375837 Number of successful extensions: 29149 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29145 Number of HSP's gapped (non-prelim): 4 length of query: 86 length of database: 1,040,396,356 effective HSP length: 56 effective length of query: 30 effective length of database: 868,058,372 effective search space: 26041751160 effective search space used: 26041751160 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 87 (38.0 bits)