BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (70 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0AAQ1 Uncharacterized protein yaiZ n=70 Tax=Enterobact... 143 2e-33 UniRef50_A7MLV4 Putative uncharacterized protein n=32 Tax=Entero... 117 2e-25 >UniRef50_P0AAQ1 Uncharacterized protein yaiZ n=70 Tax=Enterobacteriaceae RepID=YAIZ_ECOL6 Length = 70 Score = 143 bits (360), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR 60 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR Sbjct: 1 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR 60 Query: 61 RRDEETENAQ 70 RRDEETENAQ Sbjct: 61 RRDEETENAQ 70 >UniRef50_A7MLV4 Putative uncharacterized protein n=32 Tax=Enterobacteriaceae RepID=A7MLV4_ENTS8 Length = 84 Score = 117 bits (292), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 53/70 (75%), Positives = 61/70 (87%) Query: 1 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR 60 M L KIRRDWH+YA A+GLIFI+NGV+GLLGFEAKGWQTYAVGLVTW+I FW+AG IIR Sbjct: 14 MQLSAKIRRDWHFYAVALGLIFIMNGVIGLLGFEAKGWQTYAVGLVTWIICFWIAGFIIR 73 Query: 61 RRDEETENAQ 70 RR EE+ A+ Sbjct: 74 RRPEESNAAE 83 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_A7MLV4 Putative uncharacterized protein n=32 Tax=Entero... 117 1e-25 UniRef50_P0AAQ1 Uncharacterized protein yaiZ n=70 Tax=Enterobact... 113 1e-24 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_A7MLV4 Putative uncharacterized protein n=32 Tax=Enterobacteriaceae RepID=A7MLV4_ENTS8 Length = 84 Score = 117 bits (293), Expect = 1e-25, Method: Composition-based stats. Identities = 53/70 (75%), Positives = 61/70 (87%) Query: 1 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR 60 M L KIRRDWH+YA A+GLIFI+NGV+GLLGFEAKGWQTYAVGLVTW+I FW+AG IIR Sbjct: 14 MQLSAKIRRDWHFYAVALGLIFIMNGVIGLLGFEAKGWQTYAVGLVTWIICFWIAGFIIR 73 Query: 61 RRDEETENAQ 70 RR EE+ A+ Sbjct: 74 RRPEESNAAE 83 >UniRef50_P0AAQ1 Uncharacterized protein yaiZ n=70 Tax=Enterobacteriaceae RepID=YAIZ_ECOL6 Length = 70 Score = 113 bits (284), Expect = 1e-24, Method: Composition-based stats. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR 60 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR Sbjct: 1 MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR 60 Query: 61 RRDEETENAQ 70 RRDEETENAQ Sbjct: 61 RRDEETENAQ 70 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.328 0.154 0.514 Lambda K H 0.267 0.0460 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 351,563,126 Number of Sequences: 3077464 Number of extensions: 13192834 Number of successful extensions: 42560 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 42556 Number of HSP's gapped (non-prelim): 4 length of query: 70 length of database: 1,040,396,356 effective HSP length: 42 effective length of query: 28 effective length of database: 911,142,868 effective search space: 25512000304 effective search space used: 25512000304 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 87 (38.0 bits)