BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (63 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0AAN7 Uncharacterized protein yaiA n=103 Tax=Enterobac... 129 2e-29 UniRef50_C9XX52 Uncharacterized protein yaiA n=2 Tax=Cronobacter... 107 1e-22 UniRef50_A8GAI5 Putative uncharacterized protein n=2 Tax=Serrati... 48 9e-05 >UniRef50_P0AAN7 Uncharacterized protein yaiA n=103 Tax=Enterobacteriaceae RepID=YAIA_ECO57 Length = 63 Score = 129 bits (325), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP 60 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP Sbjct: 1 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP 60 Query: 61 DKE 63 DKE Sbjct: 61 DKE 63 >UniRef50_C9XX52 Uncharacterized protein yaiA n=2 Tax=Cronobacter RepID=C9XX52_CROTZ Length = 63 Score = 107 bits (267), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 50/62 (80%), Positives = 57/62 (91%) Query: 1 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP 60 MPT+PPYPREA +V +EKG PG+TVT YQLRADHP+PDSLISEHPT QEA+DAK+RYEDP Sbjct: 1 MPTRPPYPREARVVPVEKGVPGKTVTSYQLRADHPEPDSLISEHPTEQEALDAKRRYEDP 60 Query: 61 DK 62 DK Sbjct: 61 DK 62 >UniRef50_A8GAI5 Putative uncharacterized protein n=2 Tax=Serratia RepID=A8GAI5_SERP5 Length = 42 Score = 48.1 bits (113), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 20/33 (60%), Positives = 28/33 (84%) Query: 28 YQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP 60 +++R D +P++L+SEHPT QEA+DAK RYEDP Sbjct: 6 FEVRTDDIEPNTLLSEHPTEQEALDAKHRYEDP 38 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P0AAN7 Uncharacterized protein yaiA n=103 Tax=Enterobac... 96 4e-19 UniRef50_C9XX52 Uncharacterized protein yaiA n=2 Tax=Cronobacter... 90 3e-17 UniRef50_A8GAI5 Putative uncharacterized protein n=2 Tax=Serrati... 56 3e-07 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P0AAN7 Uncharacterized protein yaiA n=103 Tax=Enterobacteriaceae RepID=YAIA_ECO57 Length = 63 Score = 95.6 bits (236), Expect = 4e-19, Method: Composition-based stats. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP 60 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP Sbjct: 1 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP 60 Query: 61 DKE 63 DKE Sbjct: 61 DKE 63 >UniRef50_C9XX52 Uncharacterized protein yaiA n=2 Tax=Cronobacter RepID=C9XX52_CROTZ Length = 63 Score = 89.8 bits (221), Expect = 3e-17, Method: Composition-based stats. Identities = 50/62 (80%), Positives = 57/62 (91%) Query: 1 MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHPTAQEAMDAKKRYEDP 60 MPT+PPYPREA +V +EKG PG+TVT YQLRADHP+PDSLISEHPT QEA+DAK+RYEDP Sbjct: 1 MPTRPPYPREARVVPVEKGVPGKTVTSYQLRADHPEPDSLISEHPTEQEALDAKRRYEDP 60 Query: 61 DK 62 DK Sbjct: 61 DK 62 >UniRef50_A8GAI5 Putative uncharacterized protein n=2 Tax=Serratia RepID=A8GAI5_SERP5 Length = 42 Score = 56.3 bits (134), Expect = 3e-07, Method: Composition-based stats. Identities = 21/36 (58%), Positives = 29/36 (80%) Query: 28 YQLRADHPKPDSLISEHPTAQEAMDAKKRYEDPDKE 63 +++R D +P++L+SEHPT QEA+DAK RYEDP E Sbjct: 6 FEVRTDDIEPNTLLSEHPTEQEALDAKHRYEDPALE 41 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.293 0.129 0.385 Lambda K H 0.267 0.0400 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 289,356,034 Number of Sequences: 3077464 Number of extensions: 9164706 Number of successful extensions: 15770 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15764 Number of HSP's gapped (non-prelim): 6 length of query: 63 length of database: 1,040,396,356 effective HSP length: 35 effective length of query: 28 effective length of database: 932,685,116 effective search space: 26115183248 effective search space used: 26115183248 T: 11 A: 40 X1: 16 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (20.7 bits) S2: 87 (38.2 bits)