BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (34 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q321S5 Uncharacterized protein yoaI n=49 Tax=Enterobact... 66 4e-10 UniRef50_D2TUH6 Putative membrane protein n=1 Tax=Citrobacter ro... 53 4e-06 UniRef50_Q8ZPW6 Uncharacterized protein yoaI n=14 Tax=Salmonella... 40 0.023 >UniRef50_Q321S5 Uncharacterized protein yoaI n=49 Tax=Enterobacteriaceae RepID=YOAI_SHIBS Length = 34 Score = 65.9 bits (159), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 34/34 (100%), Positives = 34/34 (100%) Query: 1 MNDQMFVETLIITSSFFAIAVVLVLSVLLIERTG 34 MNDQMFVETLIITSSFFAIAVVLVLSVLLIERTG Sbjct: 1 MNDQMFVETLIITSSFFAIAVVLVLSVLLIERTG 34 >UniRef50_D2TUH6 Putative membrane protein n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TUH6_CITRO Length = 34 Score = 52.8 bits (125), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 25/34 (73%), Positives = 30/34 (88%) Query: 1 MNDQMFVETLIITSSFFAIAVVLVLSVLLIERTG 34 MNDQMF+ETLII SFF IA +LVLSVL++ER+G Sbjct: 1 MNDQMFIETLIIAFSFFTIAALLVLSVLILERSG 34 >UniRef50_Q8ZPW6 Uncharacterized protein yoaI n=14 Tax=Salmonella enterica RepID=YOAI_SALTY Length = 35 Score = 40.0 bits (92), Expect = 0.023, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 27/34 (79%) Query: 1 MNDQMFVETLIITSSFFAIAVVLVLSVLLIERTG 34 M D F+E L+IT+SFFAI +++V+SVLL+E G Sbjct: 1 MYDPPFLEALMITASFFAIFIIIVVSVLLLEGGG 34 Searching..................................................done ***** No hits found ****** Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.334 0.154 0.413 Lambda K H 0.267 0.0475 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 125,022,836 Number of Sequences: 3077464 Number of extensions: 2375046 Number of successful extensions: 16914 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 16908 Number of HSP's gapped (non-prelim): 6 length of query: 34 length of database: 1,040,396,356 effective HSP length: 8 effective length of query: 26 effective length of database: 1,015,776,644 effective search space: 26410192744 effective search space used: 26410192744 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 88 (38.3 bits)