BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (43 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1R788 Uncharacterized protein yqgB n=84 Tax=Enterobact... 90 2e-17 UniRef50_B5XUB0 Putative uncharacterized protein n=2 Tax=Klebsie... 42 0.007 >UniRef50_Q1R788 Uncharacterized protein yqgB n=84 Tax=Enterobacteriaceae RepID=YQGB_ECOUT Length = 43 Score = 90.1 bits (222), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII 43 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII Sbjct: 1 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII 43 >UniRef50_B5XUB0 Putative uncharacterized protein n=2 Tax=Klebsiella pneumoniae RepID=B5XUB0_KLEP3 Length = 43 Score = 42.0 bits (97), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 24/39 (61%) Query: 1 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTL 39 M KKPVAQ + Q +L +GLLS AIVVNC TL Sbjct: 1 MNKKPVAQSQNQQIVLGFRTVHGLLSHLWTAIVVNCLTL 39 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q1R788 Uncharacterized protein yqgB n=84 Tax=Enterobact... 82 5e-15 Sequences not found previously or not previously below threshold: UniRef50_B5XUB0 Putative uncharacterized protein n=2 Tax=Klebsie... 39 0.047 CONVERGED! >UniRef50_Q1R788 Uncharacterized protein yqgB n=84 Tax=Enterobacteriaceae RepID=YQGB_ECOUT Length = 43 Score = 82.0 bits (201), Expect = 5e-15, Method: Composition-based stats. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII 43 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII Sbjct: 1 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII 43 >UniRef50_B5XUB0 Putative uncharacterized protein n=2 Tax=Klebsiella pneumoniae RepID=B5XUB0_KLEP3 Length = 43 Score = 38.9 bits (89), Expect = 0.047, Method: Composition-based stats. Identities = 21/39 (53%), Positives = 24/39 (61%) Query: 1 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTL 39 M KKPVAQ + Q +L +GLLS AIVVNC TL Sbjct: 1 MNKKPVAQSQNQQIVLGFRTVHGLLSHLWTAIVVNCLTL 39 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.325 0.135 0.396 Lambda K H 0.267 0.0437 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 166,656,603 Number of Sequences: 3077464 Number of extensions: 3595331 Number of successful extensions: 8988 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8984 Number of HSP's gapped (non-prelim): 4 length of query: 43 length of database: 1,040,396,356 effective HSP length: 17 effective length of query: 26 effective length of database: 988,079,468 effective search space: 25690066168 effective search space used: 25690066168 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 87 (38.0 bits)