BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (42 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0CB62 Uncharacterized protein ymiA n=76 Tax=Enterobact... 86 5e-16 UniRef50_D2TL37 Putative membrane protein n=2 Tax=Enterobacteria... 78 1e-13 >UniRef50_P0CB62 Uncharacterized protein ymiA n=76 Tax=Enterobacteriaceae RepID=YMIA_ECOLI Length = 42 Score = 85.5 bits (210), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG 42 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG Sbjct: 1 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG 42 >UniRef50_D2TL37 Putative membrane protein n=2 Tax=Enterobacteriaceae RepID=D2TL37_CITRO Length = 53 Score = 77.8 bits (190), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 36/42 (85%), Positives = 39/42 (92%) Query: 1 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG 42 MPS NQEPRRDPELKRKAWLAVFLGSALFW++VAL+ W VWG Sbjct: 12 MPSENQEPRRDPELKRKAWLAVFLGSALFWLIVALVAWNVWG 53 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_D2TL37 Putative membrane protein n=2 Tax=Enterobacteria... 70 3e-11 UniRef50_P0CB62 Uncharacterized protein ymiA n=76 Tax=Enterobact... 65 6e-10 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_D2TL37 Putative membrane protein n=2 Tax=Enterobacteriaceae RepID=D2TL37_CITRO Length = 53 Score = 69.6 bits (169), Expect = 3e-11, Method: Composition-based stats. Identities = 36/42 (85%), Positives = 39/42 (92%) Query: 1 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG 42 MPS NQEPRRDPELKRKAWLAVFLGSALFW++VAL+ W VWG Sbjct: 12 MPSENQEPRRDPELKRKAWLAVFLGSALFWLIVALVAWNVWG 53 >UniRef50_P0CB62 Uncharacterized protein ymiA n=76 Tax=Enterobacteriaceae RepID=YMIA_ECOLI Length = 42 Score = 65.3 bits (158), Expect = 6e-10, Method: Composition-based stats. Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG 42 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG Sbjct: 1 MPSGNQEPRRDPELKRKAWLAVFLGSALFWVVVALLIWKVWG 42 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.321 0.146 0.541 Lambda K H 0.267 0.0424 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 243,478,976 Number of Sequences: 3077464 Number of extensions: 6731742 Number of successful extensions: 30644 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 30638 Number of HSP's gapped (non-prelim): 6 length of query: 42 length of database: 1,040,396,356 effective HSP length: 16 effective length of query: 26 effective length of database: 991,156,932 effective search space: 25770080232 effective search space used: 25770080232 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 87 (38.1 bits)