BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (61 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root Rep... 76 4e-13 UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorha... 53 3e-06 >UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root RepID=RZ1_BP933 Length = 61 Score = 75.9 bits (185), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 42/58 (72%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSV-SQCVKPPPPPAWIMQPPPDWQTPLNGIISPS 57 MR+LKM LCV+MLPLVV C S CVKPP PPAWIMQP PDWQTPLNGIIS S Sbjct: 1 MRELKMKLCVLMLPLVVSACGSTPPAPVPCVKPPAPPAWIMQPAPDWQTPLNGIISSS 58 >UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorhabdus nematophila RepID=Q9RIH3_XENNE Length = 69 Score = 52.8 bits (125), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGND 60 M LK + M+ L + C SK +V QC+KP PPPAW++Q PPDW+ LN I+ S + Sbjct: 1 MPNLKSLSLAMICALTLSACMSKPNV-QCLKPLPPPAWMVQDPPDWRKTLNKIMYVSSEN 59 Query: 61 W 61 W Sbjct: 60 W 60 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorha... 75 9e-13 UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root Rep... 65 7e-10 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorhabdus nematophila RepID=Q9RIH3_XENNE Length = 69 Score = 74.8 bits (182), Expect = 9e-13, Method: Composition-based stats. Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGND 60 M LK + M+ L + C SK +V QC+KP PPPAW++Q PPDW+ LN I+ S + Sbjct: 1 MPNLKSLSLAMICALTLSACMSKPNV-QCLKPLPPPAWMVQDPPDWRKTLNKIMYVSSEN 59 Query: 61 W 61 W Sbjct: 60 W 60 >UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root RepID=RZ1_BP933 Length = 61 Score = 65.2 bits (157), Expect = 7e-10, Method: Composition-based stats. Identities = 42/58 (72%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSV-SQCVKPPPPPAWIMQPPPDWQTPLNGIISPS 57 MR+LKM LCV+MLPLVV C S CVKPP PPAWIMQP PDWQTPLNGIIS S Sbjct: 1 MRELKMKLCVLMLPLVVSACGSTPPAPVPCVKPPAPPAWIMQPAPDWQTPLNGIISSS 58 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.297 0.125 0.414 Lambda K H 0.267 0.0386 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 307,834,299 Number of Sequences: 3077464 Number of extensions: 11560504 Number of successful extensions: 132808 Number of sequences better than 1.0e-01: 7 Number of HSP's better than 0.1 without gapping: 7 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 132771 Number of HSP's gapped (non-prelim): 20 length of query: 61 length of database: 1,040,396,356 effective HSP length: 33 effective length of query: 28 effective length of database: 938,840,044 effective search space: 26287521232 effective search space used: 26287521232 T: 11 A: 40 X1: 16 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (20.5 bits) S2: 87 (38.2 bits)