BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (63 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P76275 Uncharacterized protein yebW n=114 Tax=Bacteria ... 131 8e-30 UniRef50_B5XSM4 Putative uncharacterized protein n=1 Tax=Klebsie... 44 0.002 UniRef50_P29010 Uncharacterized protein ydfD n=98 Tax=Escherichi... 41 0.009 >UniRef50_P76275 Uncharacterized protein yebW n=114 Tax=Bacteria RepID=YEBW_ECOLI Length = 63 Score = 131 bits (329), Expect = 8e-30, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPAQEY 60 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPAQEY Sbjct: 1 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPAQEY 60 Query: 61 GDF 63 GDF Sbjct: 61 GDF 63 >UniRef50_B5XSM4 Putative uncharacterized protein n=1 Tax=Klebsiella pneumoniae 342 RepID=B5XSM4_KLEP3 Length = 64 Score = 43.5 bits (101), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Query: 1 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFP 45 +FALV+ VC L G C D+++ VY +E C + +Q++ QG C P Sbjct: 4 LFALVISVCALTGECSDVLIGVYPSEASCNSNADEQKV-QGQCLP 47 >UniRef50_P29010 Uncharacterized protein ydfD n=98 Tax=Escherichia RepID=YDFD_ECOLI Length = 63 Score = 41.2 bits (95), Expect = 0.009, Method: Compositional matrix adjust. Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Query: 2 FALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFI--DGFWRPA 57 F LVL V + G DI V V+ T Q+C+ + ++Q+I G C+P++ I D PA Sbjct: 5 FVLVLTVFLVSGEPVDIAVSVHRTMQECMTAATEQKI-PGNCYPVDKVIHQDNIEIPA 61 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P76275 Uncharacterized protein yebW n=114 Tax=Bacteria ... 123 1e-27 Sequences not found previously or not previously below threshold: UniRef50_B5XSM4 Putative uncharacterized protein n=1 Tax=Klebsie... 43 0.003 UniRef50_P29010 Uncharacterized protein ydfD n=98 Tax=Escherichi... 38 0.086 CONVERGED! >UniRef50_P76275 Uncharacterized protein yebW n=114 Tax=Bacteria RepID=YEBW_ECOLI Length = 63 Score = 123 bits (310), Expect = 1e-27, Method: Composition-based stats. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPAQEY 60 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPAQEY Sbjct: 1 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFIDGFWRPAQEY 60 Query: 61 GDF 63 GDF Sbjct: 61 GDF 63 >UniRef50_B5XSM4 Putative uncharacterized protein n=1 Tax=Klebsiella pneumoniae 342 RepID=B5XSM4_KLEP3 Length = 64 Score = 43.0 bits (100), Expect = 0.003, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Query: 1 MFALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFP 45 +FALV+ VC L G C D+++ VY +E C + +Q++ QG C P Sbjct: 4 LFALVISVCALTGECSDVLIGVYPSEASCNSNADEQKV-QGQCLP 47 >UniRef50_P29010 Uncharacterized protein ydfD n=98 Tax=Escherichia RepID=YDFD_ECOLI Length = 63 Score = 38.0 bits (87), Expect = 0.086, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Query: 2 FALVLFVCYLDGGCEDIVVDVYNTEQQCLYSMSDQRIRQGGCFPIEDFI 50 F LVL V + G DI V V+ T Q+C+ + ++Q+I G C+P++ I Sbjct: 5 FVLVLTVFLVSGEPVDIAVSVHRTMQECMTAATEQKI-PGNCYPVDKVI 52 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.330 0.149 0.505 Lambda K H 0.267 0.0471 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 315,594,156 Number of Sequences: 3077464 Number of extensions: 11287401 Number of successful extensions: 24567 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 24563 Number of HSP's gapped (non-prelim): 6 length of query: 63 length of database: 1,040,396,356 effective HSP length: 35 effective length of query: 28 effective length of database: 932,685,116 effective search space: 26115183248 effective search space used: 26115183248 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 88 (38.3 bits)