BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (70 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P23587 Protein flmC homolog n=12 Tax=root RepID=FLMC2_E... 127 1e-28 UniRef50_Q2VNZ1 Modulator of hok protein n=3 Tax=Escherichia col... 59 5e-08 UniRef50_C1HU91 Post-segregation killing protein (Fragment) n=7 ... 56 4e-07 >UniRef50_P23587 Protein flmC homolog n=12 Tax=root RepID=FLMC2_ECOLX Length = 70 Score = 127 bits (318), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 62/70 (88%), Positives = 63/70 (90%) Query: 1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQG 60 M HQDSLL RFAQGEEGHETTT+ CLVCVDRVSHTVDIHLSDTKIAVRDSLQRR QG Sbjct: 1 MSSPHQDSLLPRFAQGEEGHETTTKFPCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRTQG 60 Query: 61 GGGFHGLRIR 70 GGGFHGLRIR Sbjct: 61 GGGFHGLRIR 70 >UniRef50_Q2VNZ1 Modulator of hok protein n=3 Tax=Escherichia coli RepID=Q2VNZ1_ECOLX Length = 71 Score = 58.9 bits (141), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 34/70 (48%), Positives = 40/70 (57%) Query: 1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQG 60 M QHQ LL QG HETT + LV ++RV H VDIH D + VR + RIQG Sbjct: 1 MSDQHQYGLLPCKLQGGVNHETTGKRPYLVRINRVLHVVDIHTPDPESPVRSPAEGRIQG 60 Query: 61 GGGFHGLRIR 70 G +GLRIR Sbjct: 61 SYGNNGLRIR 70 >UniRef50_C1HU91 Post-segregation killing protein (Fragment) n=7 Tax=Enterobacteriaceae RepID=C1HU91_9ESCH Length = 70 Score = 55.8 bits (133), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 32/70 (45%), Positives = 40/70 (57%) Query: 1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQG 60 M Q Q LL QG HETT + LV ++RV H V+IH D + +VR + RIQG Sbjct: 1 MSDQQQYGLLPCLMQGGVNHETTGKRPYLVRINRVLHVVNIHTPDPESSVRSPAEGRIQG 60 Query: 61 GGGFHGLRIR 70 G G GLRI+ Sbjct: 61 GYGKFGLRIQ 70 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q2VNZ1 Modulator of hok protein n=3 Tax=Escherichia col... 112 4e-24 UniRef50_C1HU91 Post-segregation killing protein (Fragment) n=7 ... 112 5e-24 UniRef50_P23587 Protein flmC homolog n=12 Tax=root RepID=FLMC2_E... 111 7e-24 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_Q2VNZ1 Modulator of hok protein n=3 Tax=Escherichia coli RepID=Q2VNZ1_ECOLX Length = 71 Score = 112 bits (279), Expect = 4e-24, Method: Composition-based stats. Identities = 34/70 (48%), Positives = 40/70 (57%) Query: 1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQG 60 M QHQ LL QG HETT + LV ++RV H VDIH D + VR + RIQG Sbjct: 1 MSDQHQYGLLPCKLQGGVNHETTGKRPYLVRINRVLHVVDIHTPDPESPVRSPAEGRIQG 60 Query: 61 GGGFHGLRIR 70 G +GLRIR Sbjct: 61 SYGNNGLRIR 70 >UniRef50_C1HU91 Post-segregation killing protein (Fragment) n=7 Tax=Enterobacteriaceae RepID=C1HU91_9ESCH Length = 70 Score = 112 bits (279), Expect = 5e-24, Method: Composition-based stats. Identities = 32/70 (45%), Positives = 40/70 (57%) Query: 1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQG 60 M Q Q LL QG HETT + LV ++RV H V+IH D + +VR + RIQG Sbjct: 1 MSDQQQYGLLPCLMQGGVNHETTGKRPYLVRINRVLHVVNIHTPDPESSVRSPAEGRIQG 60 Query: 61 GGGFHGLRIR 70 G G GLRI+ Sbjct: 61 GYGKFGLRIQ 70 >UniRef50_P23587 Protein flmC homolog n=12 Tax=root RepID=FLMC2_ECOLX Length = 70 Score = 111 bits (278), Expect = 7e-24, Method: Composition-based stats. Identities = 62/70 (88%), Positives = 63/70 (90%) Query: 1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQG 60 M HQDSLL RFAQGEEGHETTT+ CLVCVDRVSHTVDIHLSDTKIAVRDSLQRR QG Sbjct: 1 MSSPHQDSLLPRFAQGEEGHETTTKFPCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRTQG 60 Query: 61 GGGFHGLRIR 70 GGGFHGLRIR Sbjct: 61 GGGFHGLRIR 70 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.318 0.140 0.386 Lambda K H 0.267 0.0428 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 265,469,333 Number of Sequences: 3077464 Number of extensions: 8007165 Number of successful extensions: 23030 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 23024 Number of HSP's gapped (non-prelim): 6 length of query: 70 length of database: 1,040,396,356 effective HSP length: 42 effective length of query: 28 effective length of database: 911,142,868 effective search space: 25512000304 effective search space used: 25512000304 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 87 (38.1 bits)