BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (86 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P33669 Putative uncharacterized protein ybbD n=24 Tax=E... 170 1e-41 UniRef50_B4SVM4 Putative inner membrane protein n=26 Tax=Salmone... 46 3e-04 >UniRef50_P33669 Putative uncharacterized protein ybbD n=24 Tax=Enterobacteriaceae RepID=YBBD_ECOLI Length = 86 Score = 170 bits (430), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLP 60 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLP Sbjct: 1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLP 60 Query: 61 DFFPHVAVDISIYTNVEDDYFFLIFP 86 DFFPHVAVDISIYTNVEDDYFFLIFP Sbjct: 61 DFFPHVAVDISIYTNVEDDYFFLIFP 86 >UniRef50_B4SVM4 Putative inner membrane protein n=26 Tax=Salmonella enterica RepID=B4SVM4_SALNS Length = 181 Score = 46.2 bits (108), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 8/69 (11%) Query: 17 AIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNV 76 A+II+ VL D+ VS ++ +Y AIPE G++TWLP FFP A +I + N+ Sbjct: 49 ALIIVAVLTAC-------DDRQVS-YFPDYAAIPEQSGIWTWLPVFFPSSASEIEMTFNL 100 Query: 77 EDDYFFLIF 85 + + F+ F Sbjct: 101 DSNLFYADF 109 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P33669 Putative uncharacterized protein ybbD n=24 Tax=E... 110 1e-23 UniRef50_B4SVM4 Putative inner membrane protein n=26 Tax=Salmone... 97 1e-19 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P33669 Putative uncharacterized protein ybbD n=24 Tax=Enterobacteriaceae RepID=YBBD_ECOLI Length = 86 Score = 110 bits (275), Expect = 1e-23, Method: Composition-based stats. Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLP 60 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLP Sbjct: 1 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLP 60 Query: 61 DFFPHVAVDISIYTNVEDDYFFLIFP 86 DFFPHVAVDISIYTNVEDDYFFLIFP Sbjct: 61 DFFPHVAVDISIYTNVEDDYFFLIFP 86 >UniRef50_B4SVM4 Putative inner membrane protein n=26 Tax=Salmonella enterica RepID=B4SVM4_SALNS Length = 181 Score = 97.4 bits (241), Expect = 1e-19, Method: Composition-based stats. Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 8/69 (11%) Query: 17 AIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNV 76 A+II+ VL D+ VS ++ +Y AIPE G++TWLP FFP A +I + N+ Sbjct: 49 ALIIVAVLTAC-------DDRQVS-YFPDYAAIPEQSGIWTWLPVFFPSSASEIEMTFNL 100 Query: 77 EDDYFFLIF 85 + + F+ F Sbjct: 101 DSNLFYADF 109 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.324 0.137 0.411 Lambda K H 0.267 0.0420 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 347,385,074 Number of Sequences: 3077464 Number of extensions: 12793405 Number of successful extensions: 59785 Number of sequences better than 1.0e-01: 4 Number of HSP's better than 0.1 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 59779 Number of HSP's gapped (non-prelim): 6 length of query: 86 length of database: 1,040,396,356 effective HSP length: 56 effective length of query: 30 effective length of database: 868,058,372 effective search space: 26041751160 effective search space used: 26041751160 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 87 (38.1 bits)