BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (72 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P11866 Threonine dehydratase operon activator protein n... 146 3e-34 >UniRef50_P11866 Threonine dehydratase operon activator protein n=60 Tax=Enterobacteriaceae RepID=TDCR_ECOLI Length = 72 Score = 146 bits (368), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSS 60 MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSS Sbjct: 1 MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSS 60 Query: 61 DRTSFCECNRFP 72 DRTSFCECNRFP Sbjct: 61 DRTSFCECNRFP 72 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P11866 Threonine dehydratase operon activator protein n... 117 1e-25 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P11866 Threonine dehydratase operon activator protein n=60 Tax=Enterobacteriaceae RepID=TDCR_ECOLI Length = 72 Score = 117 bits (293), Expect = 1e-25, Method: Composition-based stats. Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSS 60 MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSS Sbjct: 1 MSKFSNFIINKPFSVINNAACHIFSRYLLENKHLFYQYFKISNTCIDHLEQLINVNFFSS 60 Query: 61 DRTSFCECNRFP 72 DRTSFCECNRFP Sbjct: 61 DRTSFCECNRFP 72 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.331 0.140 0.448 Lambda K H 0.267 0.0446 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 330,371,619 Number of Sequences: 3077464 Number of extensions: 12556140 Number of successful extensions: 37347 Number of sequences better than 1.0e-01: 1 Number of HSP's better than 0.1 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 37345 Number of HSP's gapped (non-prelim): 2 length of query: 72 length of database: 1,040,396,356 effective HSP length: 43 effective length of query: 29 effective length of database: 908,065,404 effective search space: 26333896716 effective search space used: 26333896716 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 87 (38.0 bits)