BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (45 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0THU0 Stationary-phase-induced ribosome-associated pro... 93 3e-18 UniRef50_Q57P89 Stationary-phase-induced ribosome-associated pro... 82 7e-15 >UniRef50_Q0THU0 Stationary-phase-induced ribosome-associated protein n=47 Tax=Enterobacteriaceae RepID=SRA_ECOL5 Length = 45 Score = 92.8 bits (229), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 45/45 (100%), Positives = 45/45 (100%) Query: 1 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK 45 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK Sbjct: 1 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK 45 >UniRef50_Q57P89 Stationary-phase-induced ribosome-associated protein n=28 Tax=Enterobacteriaceae RepID=SRA_SALCH Length = 47 Score = 81.6 bits (200), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 38/44 (86%), Positives = 42/44 (95%) Query: 1 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAE 44 MKSNRQARHILGLD++ISNQRK+VTEGD SSVVNNPTGRKR A+ Sbjct: 1 MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRAD 44 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q0THU0 Stationary-phase-induced ribosome-associated pro... 68 7e-11 UniRef50_Q57P89 Stationary-phase-induced ribosome-associated pro... 65 7e-10 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_Q0THU0 Stationary-phase-induced ribosome-associated protein n=47 Tax=Enterobacteriaceae RepID=SRA_ECOL5 Length = 45 Score = 68.2 bits (165), Expect = 7e-11, Method: Composition-based stats. Identities = 45/45 (100%), Positives = 45/45 (100%) Query: 1 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK 45 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK Sbjct: 1 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAEK 45 >UniRef50_Q57P89 Stationary-phase-induced ribosome-associated protein n=28 Tax=Enterobacteriaceae RepID=SRA_SALCH Length = 47 Score = 65.1 bits (157), Expect = 7e-10, Method: Composition-based stats. Identities = 38/44 (86%), Positives = 42/44 (95%) Query: 1 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVNNPTGRKRPAE 44 MKSNRQARHILGLD++ISNQRK+VTEGD SSVVNNPTGRKR A+ Sbjct: 1 MKSNRQARHILGLDYRISNQRKVVTEGDTSSVVNNPTGRKRRAD 44 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.303 0.132 0.362 Lambda K H 0.267 0.0391 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 158,040,219 Number of Sequences: 3077464 Number of extensions: 3462948 Number of successful extensions: 5857 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5853 Number of HSP's gapped (non-prelim): 4 length of query: 45 length of database: 1,040,396,356 effective HSP length: 19 effective length of query: 26 effective length of database: 981,924,540 effective search space: 25530038040 effective search space used: 25530038040 T: 11 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.3 bits) S2: 87 (38.2 bits)