BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (60 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root Rep... 84 1e-15 UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorha... 46 3e-04 >UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root RepID=RZ1_BP933 Length = 61 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 45/61 (73%), Positives = 47/61 (77%), Gaps = 1/61 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSVS-QCVKPPRPPAWIMQPPPDWQTPLNGIISPSER 59 MR+LKM LCV+MLPLVV C S CVKPP PPAWIMQP PDWQTPLNGIIS SER Sbjct: 1 MRELKMKLCVLMLPLVVSACGSTPPAPVPCVKPPAPPAWIMQPAPDWQTPLNGIISSSER 60 Query: 60 G 60 G Sbjct: 61 G 61 >UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorhabdus nematophila RepID=Q9RIH3_XENNE Length = 69 Score = 46.2 bits (108), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPRPPAWIMQPPPDWQTPLNGIISPSERG 60 M LK + M+ L + C SK +V QC+KP PPAW++Q PPDW+ LN I+ S Sbjct: 1 MPNLKSLSLAMICALTLSACMSKPNV-QCLKPLPPPAWMVQDPPDWRKTLNKIMYVSSEN 59 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorha... 72 6e-12 UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root Rep... 68 1e-10 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_Q9RIH3 Putative uncharacterized protein n=1 Tax=Xenorhabdus nematophila RepID=Q9RIH3_XENNE Length = 69 Score = 71.7 bits (174), Expect = 6e-12, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPRPPAWIMQPPPDWQTPLNGIISPSERG 60 M LK + M+ L + C SK +V QC+KP PPAW++Q PPDW+ LN I+ S Sbjct: 1 MPNLKSLSLAMICALTLSACMSKPNV-QCLKPLPPPAWMVQDPPDWRKTLNKIMYVSSEN 59 >UniRef50_Q9XJJ7 Outer membrane lipoprotein Rz1 n=39 Tax=root RepID=RZ1_BP933 Length = 61 Score = 67.5 bits (163), Expect = 1e-10, Method: Composition-based stats. Identities = 45/61 (73%), Positives = 47/61 (77%), Gaps = 1/61 (1%) Query: 1 MRKLKMMLCVMMLPLVVVGCTSKQSVS-QCVKPPRPPAWIMQPPPDWQTPLNGIISPSER 59 MR+LKM LCV+MLPLVV C S CVKPP PPAWIMQP PDWQTPLNGIIS SER Sbjct: 1 MRELKMKLCVLMLPLVVSACGSTPPAPVPCVKPPAPPAWIMQPAPDWQTPLNGIISSSER 60 Query: 60 G 60 G Sbjct: 61 G 61 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.294 0.124 0.387 Lambda K H 0.267 0.0381 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 283,948,369 Number of Sequences: 3077464 Number of extensions: 9855170 Number of successful extensions: 114114 Number of sequences better than 1.0e-01: 7 Number of HSP's better than 0.1 without gapping: 5 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 114089 Number of HSP's gapped (non-prelim): 16 length of query: 60 length of database: 1,040,396,356 effective HSP length: 32 effective length of query: 28 effective length of database: 941,917,508 effective search space: 26373690224 effective search space used: 26373690224 T: 11 A: 40 X1: 16 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (20.4 bits) S2: 87 (38.2 bits)