BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (71 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64571 Uncharacterized protein yqgC n=31 Tax=Enterobact... 145 4e-34 >UniRef50_P64571 Uncharacterized protein yqgC n=31 Tax=Enterobacteriaceae RepID=YQGC_ECO57 Length = 71 Score = 145 bits (365), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAKTLISTRLEV 60 MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAKTLISTRLEV Sbjct: 1 MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAKTLISTRLEV 60 Query: 61 ATRKKRRVLFI 71 ATRKKRRVLFI Sbjct: 61 ATRKKRRVLFI 71 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P64571 Uncharacterized protein yqgC n=31 Tax=Enterobact... 119 3e-26 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P64571 Uncharacterized protein yqgC n=31 Tax=Enterobacteriaceae RepID=YQGC_ECO57 Length = 71 Score = 119 bits (298), Expect = 3e-26, Method: Composition-based stats. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAKTLISTRLEV 60 MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAKTLISTRLEV Sbjct: 1 MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAKTLISTRLEV 60 Query: 61 ATRKKRRVLFI 71 ATRKKRRVLFI Sbjct: 61 ATRKKRRVLFI 71 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.322 0.132 0.374 Lambda K H 0.267 0.0404 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 248,654,290 Number of Sequences: 3077464 Number of extensions: 7207129 Number of successful extensions: 25047 Number of sequences better than 1.0e-01: 1 Number of HSP's better than 0.1 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 25045 Number of HSP's gapped (non-prelim): 2 length of query: 71 length of database: 1,040,396,356 effective HSP length: 43 effective length of query: 28 effective length of database: 908,065,404 effective search space: 25425831312 effective search space used: 25425831312 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 87 (38.1 bits)