BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (32 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_C1P602 Uncharacterized membrane protein yoaK n=14 Tax=E... 61 1e-08 UniRef50_C4X6Y1 Putative uncharacterized protein n=6 Tax=Enterob... 52 7e-06 >UniRef50_C1P602 Uncharacterized membrane protein yoaK n=14 Tax=Enterobacteriaceae RepID=YOAK_ECOLI Length = 32 Score = 60.8 bits (146), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MRIGIIFPVVIFITAVVFLAWFFIGGYAAPGA 32 MRIGIIFPVVIFITAVVFLAWFFIGGYAAPGA Sbjct: 1 MRIGIIFPVVIFITAVVFLAWFFIGGYAAPGA 32 >UniRef50_C4X6Y1 Putative uncharacterized protein n=6 Tax=Enterobacteriaceae RepID=C4X6Y1_KLEPN Length = 45 Score = 51.6 bits (122), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 24/32 (75%), Positives = 28/32 (87%) Query: 1 MRIGIIFPVVIFITAVVFLAWFFIGGYAAPGA 32 M++GI+FPV IFI AVVFL WFF+GGYAAPG Sbjct: 13 MKLGILFPVAIFIIAVVFLGWFFVGGYAAPGG 44 Searching..................................................done ***** No hits found ****** Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.332 0.163 0.576 Lambda K H 0.267 0.0516 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 169,971,240 Number of Sequences: 3077464 Number of extensions: 3737240 Number of successful extensions: 32875 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 32869 Number of HSP's gapped (non-prelim): 5 length of query: 32 length of database: 1,040,396,356 effective HSP length: 7 effective length of query: 25 effective length of database: 1,018,854,108 effective search space: 25471352700 effective search space used: 25471352700 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 88 (38.2 bits)