/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/21ab7a63204e9efd/hh.d1k0ia2.model.1.pdb
MNLAIQILASYPPSGKEKGYEAQPSGGVSAHYLHYDSDIHTPDPTNALRTAVPGR
CCEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHHHHCCCCC
----++++++++++++++++++++++-----------------------------  HHscore 0.245, sequence id 36%  /bmm/www/servers/phyre2/public_html/phyre2_output/21ab7a63204e9efd/hh.d1k0ia2.model.1.pdb

0% of protein confidently modelled...
50% or less of protein confidently modelled - using mergeFragments.py
Post-synthesis iterations: 122000
Protein length: 55  of which strand: 16
Estimated time per simulation: 3 minutes
Number of repetitions of folding: 500
Estimated total CPU time: 31 hours
Estimated wallclock time on 100 processors: 0 hours