/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/19b85bd6474a458b/hh.d1w6ta2.model.1.pdb
MRFIIRTVMLIALVWIGLLLSGYGVLIGSKENAAGLGLQCTYLTARGTSTVQYLHTKSGFLGITDCPLLRKSNIVVDNG
CHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEEEEEEEEEEEEEEEEEEECCCEEEEEECCEEEEEEEEEECC
-------------------------------------++++++++++++++++++++++++++++++------------  HHscore 0.239, sequence id 30%  /bmm/www/servers/phyre2/public_html/phyre2_output/19b85bd6474a458b/hh.d1w6ta2.model.1.pdb

0% of protein confidently modelled...
50% or less of protein confidently modelled - using mergeFragments.py
Post-synthesis iterations: 131600
Protein length: 79  of which strand: 41
Estimated time per simulation: 8 minutes
Number of repetitions of folding: 500
Estimated total CPU time: 74 hours
Estimated wallclock time on 100 processors: 0 hours