BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (83 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P46879 Uncharacterized protein yqgD n=41 Tax=Enterobact... 171 1e-41 UniRef50_B5QY65 Putative inner membrane protein n=10 Tax=Enterob... 82 5e-15 >UniRef50_P46879 Uncharacterized protein yqgD n=41 Tax=Enterobacteriaceae RepID=YQGD_ECOLI Length = 83 Score = 171 bits (432), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 83/83 (100%), Positives = 83/83 (100%) Query: 1 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN 60 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN Sbjct: 1 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN 60 Query: 61 AGILRIYLLQFSAIVGYKTRRAA 83 AGILRIYLLQFSAIVGYKTRRAA Sbjct: 61 AGILRIYLLQFSAIVGYKTRRAA 83 >UniRef50_B5QY65 Putative inner membrane protein n=10 Tax=Enterobacteriaceae RepID=B5QY65_SALEP Length = 99 Score = 82.4 bits (202), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 41/78 (52%), Positives = 50/78 (64%) Query: 1 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN 60 M D T +L+V +TGSLSVN+YGWINIW AILG FF FP FFE + + DN Sbjct: 1 MTEDSTMSLKVADTGSLSVNQYGWINIWTAILGHFFAQFPAFFEGRRNVGQNQAINVSDN 60 Query: 61 AGILRIYLLQFSAIVGYK 78 A I+RIY L F ++G K Sbjct: 61 ADIMRIYALLFFCVLGIK 78 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P46879 Uncharacterized protein yqgD n=41 Tax=Enterobact... 131 7e-30 UniRef50_B5QY65 Putative inner membrane protein n=10 Tax=Enterob... 131 7e-30 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P46879 Uncharacterized protein yqgD n=41 Tax=Enterobacteriaceae RepID=YQGD_ECOLI Length = 83 Score = 131 bits (330), Expect = 7e-30, Method: Composition-based stats. Identities = 83/83 (100%), Positives = 83/83 (100%) Query: 1 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN 60 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN Sbjct: 1 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN 60 Query: 61 AGILRIYLLQFSAIVGYKTRRAA 83 AGILRIYLLQFSAIVGYKTRRAA Sbjct: 61 AGILRIYLLQFSAIVGYKTRRAA 83 >UniRef50_B5QY65 Putative inner membrane protein n=10 Tax=Enterobacteriaceae RepID=B5QY65_SALEP Length = 99 Score = 131 bits (329), Expect = 7e-30, Method: Composition-based stats. Identities = 41/78 (52%), Positives = 50/78 (64%) Query: 1 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDN 60 M D T +L+V +TGSLSVN+YGWINIW AILG FF FP FFE + + DN Sbjct: 1 MTEDSTMSLKVADTGSLSVNQYGWINIWTAILGHFFAQFPAFFEGRRNVGQNQAINVSDN 60 Query: 61 AGILRIYLLQFSAIVGYK 78 A I+RIY L F ++G K Sbjct: 61 ADIMRIYALLFFCVLGIK 78 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.327 0.140 0.447 Lambda K H 0.267 0.0429 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 365,903,003 Number of Sequences: 3077464 Number of extensions: 12576554 Number of successful extensions: 37729 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 37724 Number of HSP's gapped (non-prelim): 4 length of query: 83 length of database: 1,040,396,356 effective HSP length: 53 effective length of query: 30 effective length of database: 877,290,764 effective search space: 26318722920 effective search space used: 26318722920 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 87 (38.1 bits)