BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (44 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0AD85 PyrBI operon leader peptide n=35 Tax=Enterobacte... 92 7e-18 UniRef50_P0A1W1 PyrBI operon leader peptide n=10 Tax=Enterobacte... 60 2e-08 UniRef50_D2TNX8 PyrBI operon leader peptide n=1 Tax=Citrobacter ... 58 7e-08 >UniRef50_P0AD85 PyrBI operon leader peptide n=35 Tax=Enterobacteriaceae RepID=LPPY_ECO57 Length = 44 Score = 91.7 bits (226), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR 44 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR Sbjct: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR 44 >UniRef50_P0A1W1 PyrBI operon leader peptide n=10 Tax=Enterobacteriaceae RepID=LPPY_SALTI Length = 33 Score = 60.5 bits (145), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 28/33 (84%), Positives = 31/33 (93%) Query: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLN 33 MVQCVRH VLPRLKKDAGLPFFFPL T+++PLN Sbjct: 1 MVQCVRHSVLPRLKKDAGLPFFFPLKTNTKPLN 33 >UniRef50_D2TNX8 PyrBI operon leader peptide n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TNX8_CITRO Length = 33 Score = 58.2 bits (139), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 27/33 (81%), Positives = 30/33 (90%) Query: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLN 33 MVQCVRH VLPRLK DAGLPFFFPL+ +SQPL+ Sbjct: 1 MVQCVRHSVLPRLKADAGLPFFFPLLPYSQPLS 33 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P0AD85 PyrBI operon leader peptide n=35 Tax=Enterobacte... 75 5e-13 UniRef50_P0A1W1 PyrBI operon leader peptide n=10 Tax=Enterobacte... 56 3e-07 UniRef50_D2TNX8 PyrBI operon leader peptide n=1 Tax=Citrobacter ... 54 2e-06 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P0AD85 PyrBI operon leader peptide n=35 Tax=Enterobacteriaceae RepID=LPPY_ECO57 Length = 44 Score = 75.3 bits (184), Expect = 5e-13, Method: Composition-based stats. Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR 44 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR Sbjct: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLNRGAFFCPGVRR 44 >UniRef50_P0A1W1 PyrBI operon leader peptide n=10 Tax=Enterobacteriaceae RepID=LPPY_SALTI Length = 33 Score = 56.5 bits (135), Expect = 3e-07, Method: Composition-based stats. Identities = 28/33 (84%), Positives = 31/33 (93%) Query: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLN 33 MVQCVRH VLPRLKKDAGLPFFFPL T+++PLN Sbjct: 1 MVQCVRHSVLPRLKKDAGLPFFFPLKTNTKPLN 33 >UniRef50_D2TNX8 PyrBI operon leader peptide n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TNX8_CITRO Length = 33 Score = 53.8 bits (128), Expect = 2e-06, Method: Composition-based stats. Identities = 27/33 (81%), Positives = 30/33 (90%) Query: 1 MVQCVRHFVLPRLKKDAGLPFFFPLITHSQPLN 33 MVQCVRH VLPRLK DAGLPFFFPL+ +SQPL+ Sbjct: 1 MVQCVRHSVLPRLKADAGLPFFFPLLPYSQPLS 33 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.321 0.148 0.508 Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 226,267,138 Number of Sequences: 3077464 Number of extensions: 6336867 Number of successful extensions: 19481 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 19475 Number of HSP's gapped (non-prelim): 6 length of query: 44 length of database: 1,040,396,356 effective HSP length: 18 effective length of query: 26 effective length of database: 985,002,004 effective search space: 25610052104 effective search space used: 25610052104 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 87 (38.0 bits)