BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (44 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P76061 Uncharacterized protein ydaG n=10 Tax=Escherichi... 94 1e-18 UniRef50_C6EFM8 Predicted protein n=3 Tax=Escherichia coli RepID... 87 2e-16 >UniRef50_P76061 Uncharacterized protein ydaG n=10 Tax=Escherichia coli RepID=YDAG_ECOLI Length = 44 Score = 94.0 bits (232), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM 44 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM Sbjct: 1 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM 44 >UniRef50_C6EFM8 Predicted protein n=3 Tax=Escherichia coli RepID=C6EFM8_ECOBD Length = 44 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 39/44 (88%), Positives = 42/44 (95%) Query: 1 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM 44 MVHYEVVQYLMDCCGITY+ AVQALRSNDWDLWQAE +IR+NKM Sbjct: 1 MVHYEVVQYLMDCCGITYSPAVQALRSNDWDLWQAEASIRNNKM 44 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_C6EFM8 Predicted protein n=3 Tax=Escherichia coli RepID... 79 4e-14 UniRef50_P76061 Uncharacterized protein ydaG n=10 Tax=Escherichi... 76 3e-13 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_C6EFM8 Predicted protein n=3 Tax=Escherichia coli RepID=C6EFM8_ECOBD Length = 44 Score = 79.3 bits (194), Expect = 4e-14, Method: Composition-based stats. Identities = 39/44 (88%), Positives = 42/44 (95%) Query: 1 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM 44 MVHYEVVQYLMDCCGITY+ AVQALRSNDWDLWQAE +IR+NKM Sbjct: 1 MVHYEVVQYLMDCCGITYSPAVQALRSNDWDLWQAEASIRNNKM 44 >UniRef50_P76061 Uncharacterized protein ydaG n=10 Tax=Escherichia coli RepID=YDAG_ECOLI Length = 44 Score = 76.2 bits (186), Expect = 3e-13, Method: Composition-based stats. Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM 44 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM Sbjct: 1 MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM 44 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.324 0.140 0.468 Lambda K H 0.267 0.0420 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 175,069,942 Number of Sequences: 3077464 Number of extensions: 3779775 Number of successful extensions: 13833 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13829 Number of HSP's gapped (non-prelim): 4 length of query: 44 length of database: 1,040,396,356 effective HSP length: 18 effective length of query: 26 effective length of database: 985,002,004 effective search space: 25610052104 effective search space used: 25610052104 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 87 (38.1 bits)