BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (81 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0ACV8 Uncharacterized protein ymjA n=72 Tax=Enterobact... 167 1e-40 UniRef50_C9Y5F1 Uncharacterized protein ymjA n=3 Tax=Enterobacte... 130 1e-29 >UniRef50_P0ACV8 Uncharacterized protein ymjA n=72 Tax=Enterobacteriaceae RepID=YMJA_ECOLI Length = 81 Score = 167 bits (422), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 81/81 (100%), Positives = 81/81 (100%) Query: 1 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE 60 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE Sbjct: 1 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE 60 Query: 61 AGINPVRIDEIAEFLNQWGNE 81 AGINPVRIDEIAEFLNQWGNE Sbjct: 61 AGINPVRIDEIAEFLNQWGNE 81 >UniRef50_C9Y5F1 Uncharacterized protein ymjA n=3 Tax=Enterobacteriaceae RepID=C9Y5F1_CROTZ Length = 81 Score = 130 bits (328), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 62/81 (76%), Positives = 72/81 (88%) Query: 1 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE 60 M++DIP+K++DIADEYATE A PV++A+R LAHYFQLL+TRLMNNEEISEEAQHEMA+E Sbjct: 1 MSNDIPIKFYDIADEYATETALPVSDADRDRLAHYFQLLITRLMNNEEISEEAQHEMASE 60 Query: 61 AGINPVRIDEIAEFLNQWGNE 81 AGI IDEIA FLNQWGNE Sbjct: 61 AGIAEAHIDEIANFLNQWGNE 81 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P0ACV8 Uncharacterized protein ymjA n=72 Tax=Enterobact... 135 4e-31 UniRef50_C9Y5F1 Uncharacterized protein ymjA n=3 Tax=Enterobacte... 133 2e-30 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P0ACV8 Uncharacterized protein ymjA n=72 Tax=Enterobacteriaceae RepID=YMJA_ECOLI Length = 81 Score = 135 bits (340), Expect = 4e-31, Method: Composition-based stats. Identities = 81/81 (100%), Positives = 81/81 (100%) Query: 1 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE 60 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE Sbjct: 1 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE 60 Query: 61 AGINPVRIDEIAEFLNQWGNE 81 AGINPVRIDEIAEFLNQWGNE Sbjct: 61 AGINPVRIDEIAEFLNQWGNE 81 >UniRef50_C9Y5F1 Uncharacterized protein ymjA n=3 Tax=Enterobacteriaceae RepID=C9Y5F1_CROTZ Length = 81 Score = 133 bits (334), Expect = 2e-30, Method: Composition-based stats. Identities = 62/81 (76%), Positives = 72/81 (88%) Query: 1 MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAE 60 M++DIP+K++DIADEYATE A PV++A+R LAHYFQLL+TRLMNNEEISEEAQHEMA+E Sbjct: 1 MSNDIPIKFYDIADEYATETALPVSDADRDRLAHYFQLLITRLMNNEEISEEAQHEMASE 60 Query: 61 AGINPVRIDEIAEFLNQWGNE 81 AGI IDEIA FLNQWGNE Sbjct: 61 AGIAEAHIDEIANFLNQWGNE 81 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.312 0.137 0.392 Lambda K H 0.267 0.0397 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 292,925,182 Number of Sequences: 3077464 Number of extensions: 8874876 Number of successful extensions: 27926 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 27922 Number of HSP's gapped (non-prelim): 4 length of query: 81 length of database: 1,040,396,356 effective HSP length: 52 effective length of query: 29 effective length of database: 880,368,228 effective search space: 25530678612 effective search space used: 25530678612 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.3 bits) S2: 87 (38.2 bits)