BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (92 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8XBB1 Putative lambdoid prophage defective integrase n... 166 2e-40 UniRef50_UPI0001826473 putative integrase n=1 Tax=Enterobacter c... 78 9e-14 UniRef50_P76168 Putative lambdoid prophage Qin defective integra... 58 1e-07 UniRef50_B6XGP6 Putative uncharacterized protein n=1 Tax=Provide... 53 4e-06 UniRef50_A8GE25 Integrase family protein n=18 Tax=Enterobacteria... 47 1e-04 UniRef50_D0Z3D7 Putative integrase n=1 Tax=Photobacterium damsel... 39 0.056 >UniRef50_Q8XBB1 Putative lambdoid prophage defective integrase n=6 Tax=Escherichia RepID=INTG_ECO57 Length = 92 Score = 166 bits (420), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 81/92 (88%), Positives = 85/92 (92%) Query: 1 MVVTTSDVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDVI 60 MVVTTSDVVMCQMR SDVQG YRVYGSWMAEN QDQVSI NQ +S+FAPSMPHAVRSDVI Sbjct: 1 MVVTTSDVVMCQMRHSDVQGVYRVYGSWMAENFQDQVSISNQIMSKFAPSMPHAVRSDVI 60 Query: 61 NNRLQNLHLHAHHFLIRRHQLITHLNPHLHRN 92 NNRL NL+LHAH+FLI RHQLITHLNPHLHRN Sbjct: 61 NNRLHNLYLHAHYFLICRHQLITHLNPHLHRN 92 >UniRef50_UPI0001826473 putative integrase n=1 Tax=Enterobacter cancerogenus ATCC 35316 RepID=UPI0001826473 Length = 431 Score = 77.8 bits (190), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 37/53 (69%), Positives = 40/53 (75%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDV 59 + + QM +D Q YRVYGSWMAEN QDQV ILNQKLSEFAPSMPHA SD Sbjct: 378 NFIAKQMGHTDAQMVYRVYGSWMAENNQDQVLILNQKLSEFAPSMPHATGSDA 430 >UniRef50_P76168 Putative lambdoid prophage Qin defective integrase (Fragment) n=64 Tax=root RepID=INTQ_ECOLI Length = 385 Score = 57.8 bits (138), Expect = 1e-07, Method: Composition-based stats. Identities = 24/42 (57%), Positives = 32/42 (76%) Query: 12 QMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPH 53 QM +D Q ++VYG WM+EN QV++LN +LSEFAP+MPH Sbjct: 338 QMGHADAQMVFQVYGKWMSENNNAQVALLNTQLSEFAPTMPH 379 >UniRef50_B6XGP6 Putative uncharacterized protein n=1 Tax=Providencia alcalifaciens DSM 30120 RepID=B6XGP6_9ENTR Length = 427 Score = 52.8 bits (125), Expect = 4e-06, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 4/54 (7%) Query: 9 VMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDVINN 62 + QM S + Y VYG+WM EN +DQ++I+N+ AP MPH + S VIN+ Sbjct: 378 IATQMGHSSAKMIYDVYGAWMKENDKDQIAIMNRN----APHMPHPIESKVINS 427 >UniRef50_A8GE25 Integrase family protein n=18 Tax=Enterobacteriaceae RepID=A8GE25_SERP5 Length = 428 Score = 47.4 bits (111), Expect = 1e-04, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 27/47 (57%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPH 53 + V QM S Q Y VYG WM EN QV+ILN S+ AP +PH Sbjct: 376 NFVAHQMGHSSAQMLYNVYGKWMTENNDHQVNILNASFSQNAPQVPH 422 >UniRef50_D0Z3D7 Putative integrase n=1 Tax=Photobacterium damselae subsp. damselae CIP 102761 RepID=D0Z3D7_LISDA Length = 428 Score = 38.9 bits (89), Expect = 0.056, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 29/49 (59%) Query: 9 VMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRS 57 + QM SD+ VYG+WM N + +++ + ++L+ APS PH ++ Sbjct: 379 IASQMGHSDMSMVISVYGAWMPSNNESEIAKIERQLNCIAPSAPHQKKT 427 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q8XBB1 Putative lambdoid prophage defective integrase n... 138 4e-32 UniRef50_UPI0001826473 putative integrase n=1 Tax=Enterobacter c... 98 7e-20 UniRef50_B6XGP6 Putative uncharacterized protein n=1 Tax=Provide... 89 3e-17 UniRef50_P76168 Putative lambdoid prophage Qin defective integra... 85 8e-16 UniRef50_A8GE25 Integrase family protein n=18 Tax=Enterobacteria... 84 1e-15 Sequences not found previously or not previously below threshold: UniRef50_D0Z3D7 Putative integrase n=1 Tax=Photobacterium damsel... 59 6e-08 UniRef50_A2P3A8 Integrase n=3 Tax=Vibrionaceae RepID=A2P3A8_VIBCH 55 6e-07 UniRef50_C6DJ77 Integrase family protein n=4 Tax=Enterobacteriac... 54 1e-06 UniRef50_P76056 Putative lambdoid prophage Rac integrase n=30 Ta... 53 2e-06 UniRef50_C9Y3T7 Putative uncharacterized protein n=1 Tax=Cronoba... 47 2e-04 UniRef50_D0Z9J8 Putative integrase n=1 Tax=Edwardsiella tarda EI... 42 0.005 UniRef50_A7MYL9 Putative uncharacterized protein n=3 Tax=Vibrio ... 42 0.008 UniRef50_A4WAT6 Putative uncharacterized protein n=1 Tax=Enterob... 40 0.033 >UniRef50_Q8XBB1 Putative lambdoid prophage defective integrase n=6 Tax=Escherichia RepID=INTG_ECO57 Length = 92 Score = 138 bits (348), Expect = 4e-32, Method: Composition-based stats. Identities = 81/92 (88%), Positives = 85/92 (92%) Query: 1 MVVTTSDVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDVI 60 MVVTTSDVVMCQMR SDVQG YRVYGSWMAEN QDQVSI NQ +S+FAPSMPHAVRSDVI Sbjct: 1 MVVTTSDVVMCQMRHSDVQGVYRVYGSWMAENFQDQVSISNQIMSKFAPSMPHAVRSDVI 60 Query: 61 NNRLQNLHLHAHHFLIRRHQLITHLNPHLHRN 92 NNRL NL+LHAH+FLI RHQLITHLNPHLHRN Sbjct: 61 NNRLHNLYLHAHYFLICRHQLITHLNPHLHRN 92 >UniRef50_UPI0001826473 putative integrase n=1 Tax=Enterobacter cancerogenus ATCC 35316 RepID=UPI0001826473 Length = 431 Score = 98.2 bits (243), Expect = 7e-20, Method: Composition-based stats. Identities = 37/53 (69%), Positives = 40/53 (75%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDV 59 + + QM +D Q YRVYGSWMAEN QDQV ILNQKLSEFAPSMPHA SD Sbjct: 378 NFIAKQMGHTDAQMVYRVYGSWMAENNQDQVLILNQKLSEFAPSMPHATGSDA 430 >UniRef50_B6XGP6 Putative uncharacterized protein n=1 Tax=Providencia alcalifaciens DSM 30120 RepID=B6XGP6_9ENTR Length = 427 Score = 89.4 bits (220), Expect = 3e-17, Method: Composition-based stats. Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDVINN 62 + QM S + Y VYG+WM EN +DQ++I+N+ AP MPH + S VIN+ Sbjct: 377 FIATQMGHSSAKMIYDVYGAWMKENDKDQIAIMNRN----APHMPHPIESKVINS 427 >UniRef50_P76168 Putative lambdoid prophage Qin defective integrase (Fragment) n=64 Tax=root RepID=INTQ_ECOLI Length = 385 Score = 84.7 bits (208), Expect = 8e-16, Method: Composition-based stats. Identities = 24/46 (52%), Positives = 33/46 (71%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPH 53 + QM +D Q ++VYG WM+EN QV++LN +LSEFAP+MPH Sbjct: 334 FIANQMGHADAQMVFQVYGKWMSENNNAQVALLNTQLSEFAPTMPH 379 >UniRef50_A8GE25 Integrase family protein n=18 Tax=Enterobacteriaceae RepID=A8GE25_SERP5 Length = 428 Score = 84.3 bits (207), Expect = 1e-15, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 27/47 (57%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPH 53 + V QM S Q Y VYG WM EN QV+ILN S+ AP +PH Sbjct: 376 NFVAHQMGHSSAQMLYNVYGKWMTENNDHQVNILNASFSQNAPQVPH 422 >UniRef50_D0Z3D7 Putative integrase n=1 Tax=Photobacterium damselae subsp. damselae CIP 102761 RepID=D0Z3D7_LISDA Length = 428 Score = 58.5 bits (140), Expect = 6e-08, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 27/46 (58%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPH 53 + QM SD+ VYG+WM N + +++ + ++L+ APS PH Sbjct: 378 FIASQMGHSDMSMVISVYGAWMPSNNESEIAKIERQLNCIAPSAPH 423 >UniRef50_A2P3A8 Integrase n=3 Tax=Vibrionaceae RepID=A2P3A8_VIBCH Length = 412 Score = 55.1 bits (131), Expect = 6e-07, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 24/51 (47%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSD 58 + QM S + Y+ YG W+ ++ + Q+ +LN + AP P S Sbjct: 361 FIAKQMGHSSAKEVYQTYGDWVGDHTKGQLDMLNARYGNIAPYTPQGKESK 411 >UniRef50_C6DJ77 Integrase family protein n=4 Tax=Enterobacteriaceae RepID=C6DJ77_PECCP Length = 255 Score = 54.3 bits (129), Expect = 1e-06, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 23/39 (58%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLS 45 + QM + Q Y +YG W+ + +DQV +LN+KL+ Sbjct: 216 SFIANQMGHENAQMVYEIYGKWIEDMNEDQVGMLNRKLA 254 >UniRef50_P76056 Putative lambdoid prophage Rac integrase n=30 Tax=Bacteria RepID=INTR_ECOLI Length = 411 Score = 53.1 bits (126), Expect = 2e-06, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLS 45 + QM Q Y +YG W+ + +Q+++LN +LS Sbjct: 374 FIASQMGHETAQMVYEIYGMWIDDMNDEQIAMLNARLS 411 >UniRef50_C9Y3T7 Putative uncharacterized protein n=1 Tax=Cronobacter turicensis RepID=C9Y3T7_CROTZ Length = 78 Score = 46.6 bits (109), Expect = 2e-04, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQK 43 + + QM ++ Q + Y W++ D ++ILN Sbjct: 40 NFIANQMGHTNAQMVFNFYAKWISIKNIDPIAILNLN 76 >UniRef50_D0Z9J8 Putative integrase n=1 Tax=Edwardsiella tarda EIB202 RepID=D0Z9J8_EDWTE Length = 48 Score = 42.4 bits (98), Expect = 0.005, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 23/42 (54%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFA 48 +V ++ +D Q Y+ G WM++ Q++ILNQ L A Sbjct: 6 NVTAPRLGHADAQRMYKAEGKWMSDKNAAQLAILNQCLITEA 47 >UniRef50_A7MYL9 Putative uncharacterized protein n=3 Tax=Vibrio harveyi group RepID=A7MYL9_VIBHB Length = 411 Score = 41.6 bits (96), Expect = 0.008, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 17/41 (41%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEF 47 + QM RVYG +M + +Q+ LN ++ Sbjct: 370 SFIAEQMGHKSTMMLERVYGRFMKSHSHEQIEYLNGIMASN 410 >UniRef50_A4WAT6 Putative uncharacterized protein n=1 Tax=Enterobacter sp. 638 RepID=A4WAT6_ENT38 Length = 140 Score = 39.7 bits (91), Expect = 0.033, Method: Composition-based stats. Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKL 44 + M + Q Y +Y +W+ +QV++LN L Sbjct: 89 SFITNPMGHENAQRVYEIYATWIEALNSEQVAMLNPTL 126 Searching..................................................done Results from round 3 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q8XBB1 Putative lambdoid prophage defective integrase n... 135 6e-31 UniRef50_UPI0001826473 putative integrase n=1 Tax=Enterobacter c... 97 2e-19 UniRef50_B6XGP6 Putative uncharacterized protein n=1 Tax=Provide... 89 6e-17 UniRef50_P76168 Putative lambdoid prophage Qin defective integra... 87 2e-16 UniRef50_A8GE25 Integrase family protein n=18 Tax=Enterobacteria... 82 7e-15 UniRef50_A2P3A8 Integrase n=3 Tax=Vibrionaceae RepID=A2P3A8_VIBCH 80 2e-14 UniRef50_D0Z3D7 Putative integrase n=1 Tax=Photobacterium damsel... 77 1e-13 UniRef50_C6DJ77 Integrase family protein n=4 Tax=Enterobacteriac... 68 8e-11 UniRef50_P76056 Putative lambdoid prophage Rac integrase n=30 Ta... 67 1e-10 UniRef50_C9Y3T7 Putative uncharacterized protein n=1 Tax=Cronoba... 60 3e-08 Sequences not found previously or not previously below threshold: UniRef50_A4WAT6 Putative uncharacterized protein n=1 Tax=Enterob... 50 2e-05 UniRef50_A7MYL9 Putative uncharacterized protein n=3 Tax=Vibrio ... 45 0.001 UniRef50_B0KSD4 Integrase family protein n=1 Tax=Pseudomonas put... 43 0.002 UniRef50_D0Z9J8 Putative integrase n=1 Tax=Edwardsiella tarda EI... 42 0.005 UniRef50_D1SSC0 Putative uncharacterized protein n=1 Tax=Acidovo... 41 0.010 UniRef50_A8T0M8 Putative integrase n=1 Tax=Vibrio sp. AND4 RepID... 40 0.017 UniRef50_B7WRL6 Bbp50 n=1 Tax=Comamonas testosteroni KF-1 RepID=... 40 0.019 UniRef50_C1D584 Phage integrase n=1 Tax=Laribacter hongkongensis... 40 0.020 UniRef50_Q2T7M7 Bbp50 n=13 Tax=root RepID=Q2T7M7_BURTA 39 0.035 UniRef50_UPI0001873836 hypothetical protein PSPTOT1_3787 n=1 Tax... 39 0.037 UniRef50_D0J3Y8 Phage integrase n=5 Tax=Burkholderiales RepID=D0... 39 0.043 UniRef50_A8HM00 Phage integrase n=5 Tax=Proteobacteria RepID=A8H... 39 0.057 UniRef50_A5F0P2 Integrase-related protein n=30 Tax=Vibrio RepID=... 38 0.065 UniRef50_Q4KFM1 Integrase n=1 Tax=Pseudomonas fluorescens Pf-5 R... 38 0.076 >UniRef50_Q8XBB1 Putative lambdoid prophage defective integrase n=6 Tax=Escherichia RepID=INTG_ECO57 Length = 92 Score = 135 bits (339), Expect = 6e-31, Method: Composition-based stats. Identities = 81/92 (88%), Positives = 85/92 (92%) Query: 1 MVVTTSDVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDVI 60 MVVTTSDVVMCQMR SDVQG YRVYGSWMAEN QDQVSI NQ +S+FAPSMPHAVRSDVI Sbjct: 1 MVVTTSDVVMCQMRHSDVQGVYRVYGSWMAENFQDQVSISNQIMSKFAPSMPHAVRSDVI 60 Query: 61 NNRLQNLHLHAHHFLIRRHQLITHLNPHLHRN 92 NNRL NL+LHAH+FLI RHQLITHLNPHLHRN Sbjct: 61 NNRLHNLYLHAHYFLICRHQLITHLNPHLHRN 92 >UniRef50_UPI0001826473 putative integrase n=1 Tax=Enterobacter cancerogenus ATCC 35316 RepID=UPI0001826473 Length = 431 Score = 96.6 bits (239), Expect = 2e-19, Method: Composition-based stats. Identities = 37/53 (69%), Positives = 40/53 (75%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDV 59 + + QM +D Q YRVYGSWMAEN QDQV ILNQKLSEFAPSMPHA SD Sbjct: 378 NFIAKQMGHTDAQMVYRVYGSWMAENNQDQVLILNQKLSEFAPSMPHATGSDA 430 >UniRef50_B6XGP6 Putative uncharacterized protein n=1 Tax=Providencia alcalifaciens DSM 30120 RepID=B6XGP6_9ENTR Length = 427 Score = 88.5 bits (218), Expect = 6e-17, Method: Composition-based stats. Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSDVINN 62 + QM S + Y VYG+WM EN +DQ++I+N+ AP MPH + S VIN+ Sbjct: 377 FIATQMGHSSAKMIYDVYGAWMKENDKDQIAIMNRN----APHMPHPIESKVINS 427 >UniRef50_P76168 Putative lambdoid prophage Qin defective integrase (Fragment) n=64 Tax=root RepID=INTQ_ECOLI Length = 385 Score = 86.6 bits (213), Expect = 2e-16, Method: Composition-based stats. Identities = 24/46 (52%), Positives = 33/46 (71%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPH 53 + QM +D Q ++VYG WM+EN QV++LN +LSEFAP+MPH Sbjct: 334 FIANQMGHADAQMVFQVYGKWMSENNNAQVALLNTQLSEFAPTMPH 379 >UniRef50_A8GE25 Integrase family protein n=18 Tax=Enterobacteriaceae RepID=A8GE25_SERP5 Length = 428 Score = 81.6 bits (200), Expect = 7e-15, Method: Composition-based stats. Identities = 23/47 (48%), Positives = 27/47 (57%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPH 53 + V QM S Q Y VYG WM EN QV+ILN S+ AP +PH Sbjct: 376 NFVAHQMGHSSAQMLYNVYGKWMTENNDHQVNILNASFSQNAPQVPH 422 >UniRef50_A2P3A8 Integrase n=3 Tax=Vibrionaceae RepID=A2P3A8_VIBCH Length = 412 Score = 79.7 bits (195), Expect = 2e-14, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 24/51 (47%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRSD 58 + QM S + Y+ YG W+ ++ + Q+ +LN + AP P S Sbjct: 361 FIAKQMGHSSAKEVYQTYGDWVGDHTKGQLDMLNARYGNIAPYTPQGKESK 411 >UniRef50_D0Z3D7 Putative integrase n=1 Tax=Photobacterium damselae subsp. damselae CIP 102761 RepID=D0Z3D7_LISDA Length = 428 Score = 77.4 bits (189), Expect = 1e-13, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 29/50 (58%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEFAPSMPHAVRS 57 + QM SD+ VYG+WM N + +++ + ++L+ APS PH ++ Sbjct: 378 FIASQMGHSDMSMVISVYGAWMPSNNESEIAKIERQLNCIAPSAPHQKKT 427 >UniRef50_C6DJ77 Integrase family protein n=4 Tax=Enterobacteriaceae RepID=C6DJ77_PECCP Length = 255 Score = 68.1 bits (165), Expect = 8e-11, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 23/39 (58%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLS 45 + QM + Q Y +YG W+ + +DQV +LN+KL+ Sbjct: 216 SFIANQMGHENAQMVYEIYGKWIEDMNEDQVGMLNRKLA 254 >UniRef50_P76056 Putative lambdoid prophage Rac integrase n=30 Tax=Bacteria RepID=INTR_ECOLI Length = 411 Score = 67.4 bits (163), Expect = 1e-10, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLS 45 + QM Q Y +YG W+ + +Q+++LN +LS Sbjct: 374 FIASQMGHETAQMVYEIYGMWIDDMNDEQIAMLNARLS 411 >UniRef50_C9Y3T7 Putative uncharacterized protein n=1 Tax=Cronobacter turicensis RepID=C9Y3T7_CROTZ Length = 78 Score = 59.7 bits (143), Expect = 3e-08, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQK 43 + + QM ++ Q + Y W++ D ++ILN Sbjct: 40 NFIANQMGHTNAQMVFNFYAKWISIKNIDPIAILNLN 76 >UniRef50_A4WAT6 Putative uncharacterized protein n=1 Tax=Enterobacter sp. 638 RepID=A4WAT6_ENT38 Length = 140 Score = 50.0 bits (118), Expect = 2e-05, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 18/39 (46%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLS 45 + M + Q Y +Y +W+ +QV++LN L Sbjct: 89 SFITNPMGHENAQRVYEIYATWIEALNSEQVAMLNPTLG 127 >UniRef50_A7MYL9 Putative uncharacterized protein n=3 Tax=Vibrio harveyi group RepID=A7MYL9_VIBHB Length = 411 Score = 44.6 bits (104), Expect = 0.001, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 17/41 (41%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKLSEF 47 + QM RVYG +M + +Q+ LN ++ Sbjct: 370 SFIAEQMGHKSTMMLERVYGRFMKSHSHEQIEYLNGIMASN 410 >UniRef50_B0KSD4 Integrase family protein n=1 Tax=Pseudomonas putida GB-1 RepID=B0KSD4_PSEPG Length = 417 Score = 43.5 bits (101), Expect = 0.002, Method: Composition-based stats. Identities = 7/33 (21%), Positives = 13/33 (39%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQVSIL 40 + QM D VY WM ++++ + Sbjct: 372 FIAKQMGHKDFTMLVEVYAKWMDSESDEELTRI 404 >UniRef50_D0Z9J8 Putative integrase n=1 Tax=Edwardsiella tarda EIB202 RepID=D0Z9J8_EDWTE Length = 48 Score = 42.3 bits (98), Expect = 0.005, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKL 44 +V ++ +D Q Y+ G WM++ Q++ILNQ L Sbjct: 6 NVTAPRLGHADAQRMYKAEGKWMSDKNAAQLAILNQCL 43 >UniRef50_D1SSC0 Putative uncharacterized protein n=1 Tax=Acidovorax avenae subsp. avenae ATCC 19860 RepID=D1SSC0_9BURK Length = 125 Score = 41.2 bits (95), Expect = 0.010, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQD-QVSILNQKLSEF 47 + QM + + + VY W+ + + + + + Q L E Sbjct: 71 YIARQMGHKNAKMLFIVYAKWIDDADRGREKAKIEQMLVEM 111 >UniRef50_A8T0M8 Putative integrase n=1 Tax=Vibrio sp. AND4 RepID=A8T0M8_9VIBR Length = 407 Score = 40.4 bits (93), Expect = 0.017, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 11/29 (37%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQ 36 + QM S+ VYG WM + Sbjct: 365 YLAQQMGHSNFLMIASVYGKWMKNKNASE 393 >UniRef50_B7WRL6 Bbp50 n=1 Tax=Comamonas testosteroni KF-1 RepID=B7WRL6_COMTE Length = 323 Score = 40.4 bits (93), Expect = 0.019, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Query: 1 MVVTTSDVVMCQMRRSDVQGGYRVYGSWMAENVQD-QVSILNQKLSEFAPSMP 52 M T QM S + VY W+ + D + + L + + +P P Sbjct: 265 MAGATPAYAAKQMGHS-AEMFLSVYSKWLDDGQGDIEQAKLESFIGQNSPGTP 316 >UniRef50_C1D584 Phage integrase n=1 Tax=Laribacter hongkongensis HLHK9 RepID=C1D584_LARHH Length = 416 Score = 40.0 bits (92), Expect = 0.020, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMA--ENVQDQVSI 39 V QM + RVYG W+ +N Q ++ Sbjct: 349 WVANQMGHASWTMIARVYGRWIPNGDNGDGQKAV 382 >UniRef50_Q2T7M7 Bbp50 n=13 Tax=root RepID=Q2T7M7_BURTA Length = 356 Score = 39.2 bits (90), Expect = 0.035, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Query: 1 MVVTTSDVVMCQMRRSDVQGGYRVYGSWM-AENVQDQVSILNQKLSEFAPSMPHAVR 56 M T Q+ S V+ Y W+ + +++ L + +S +P P A Sbjct: 300 MAGMTPAFCAKQLGHS-VEMFLTTYSKWIDGDQNDLEMARLERAIS--SPEPPQAKE 353 >UniRef50_UPI0001873836 hypothetical protein PSPTOT1_3787 n=1 Tax=Pseudomonas syringae pv. tomato T1 RepID=UPI0001873836 Length = 184 Score = 39.2 bits (90), Expect = 0.037, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 21/42 (50%) Query: 3 VTTSDVVMCQMRRSDVQGGYRVYGSWMAENVQDQVSILNQKL 44 V + D QM +D ++ YG+W+ E+ D + +L L Sbjct: 141 VASIDWSAEQMGHTDGNMIHKHYGTWINEDGPDVIGMLEHAL 182 >UniRef50_D0J3Y8 Phage integrase n=5 Tax=Burkholderiales RepID=D0J3Y8_COMTE Length = 394 Score = 39.2 bits (90), Expect = 0.043, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 15/29 (51%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAENVQDQ 36 V Q+ DV+ +R YG ++ ++ Q Sbjct: 356 YVASQLGHEDVEMVFRTYGKFIRDDYQKP 384 >UniRef50_A8HM00 Phage integrase n=5 Tax=Proteobacteria RepID=A8HM00_BURPS Length = 411 Score = 38.9 bits (89), Expect = 0.057, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 11/24 (45%) Query: 8 VVMCQMRRSDVQGGYRVYGSWMAE 31 V QM D + + YG W+ + Sbjct: 361 WVAQQMGHVDTEMITKTYGKWIPD 384 >UniRef50_A5F0P2 Integrase-related protein n=30 Tax=Vibrio RepID=A5F0P2_VIBC3 Length = 53 Score = 38.5 bits (88), Expect = 0.065, Method: Composition-based stats. Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 7 DVVMCQMRRSDVQGGYRVYGSWMAENVQDQ 36 + QM +D+ RVYG W+ E+ + + Sbjct: 10 SYLAQQMGHADITMVARVYGKWLVESNKKE 39 >UniRef50_Q4KFM1 Integrase n=1 Tax=Pseudomonas fluorescens Pf-5 RepID=Q4KFM1_PSEF5 Length = 154 Score = 38.5 bits (88), Expect = 0.076, Method: Composition-based stats. Identities = 8/30 (26%), Positives = 16/30 (53%) Query: 3 VTTSDVVMCQMRRSDVQGGYRVYGSWMAEN 32 V + D + QM ++ + YG+W+ E+ Sbjct: 125 VASIDWIAEQMGHTNANMIRQHYGTWINED 154 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.315 0.138 0.423 Lambda K H 0.267 0.0419 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 585,005,799 Number of Sequences: 3077464 Number of extensions: 19292829 Number of successful extensions: 71417 Number of sequences better than 1.0e-01: 25 Number of HSP's better than 0.1 without gapping: 42 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 71371 Number of HSP's gapped (non-prelim): 45 length of query: 92 length of database: 1,040,396,356 effective HSP length: 62 effective length of query: 30 effective length of database: 849,593,588 effective search space: 25487807640 effective search space used: 25487807640 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 87 (38.1 bits)