BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (60 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P75979 Uncharacterized protein ymfR n=19 Tax=root RepID... 115 3e-25 UniRef50_C8Q8L1 Putative uncharacterized protein n=1 Tax=Pantoea... 80 2e-14 UniRef50_Q6UAX9 Gp3 n=1 Tax=Klebsiella phage phiKO2 RepID=Q6UAX9... 57 2e-07 UniRef50_B0VK30 Putative prophage protein n=2 Tax=root RepID=B0V... 40 0.019 >UniRef50_P75979 Uncharacterized protein ymfR n=19 Tax=root RepID=YMFR_ECOLI Length = 60 Score = 115 bits (289), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK 60 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK Sbjct: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK 60 >UniRef50_C8Q8L1 Putative uncharacterized protein n=1 Tax=Pantoea sp. At-9b RepID=C8Q8L1_9ENTR Length = 61 Score = 79.7 bits (195), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 36/60 (60%), Positives = 49/60 (81%) Query: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK 60 M+++ILAP++G+LGA L+A+GAW IY PAGF+ AGALCLFWSW V++YL + + GGG Sbjct: 1 MVLIILAPVIGLLGAALIAFGAWQIYEPAGFITAGALCLFWSWAVSQYLSIPRKTSGGGD 60 >UniRef50_Q6UAX9 Gp3 n=1 Tax=Klebsiella phage phiKO2 RepID=Q6UAX9_9CAUD Length = 59 Score = 57.0 bits (136), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 41/57 (71%) Query: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVG 57 M++ IL+ ++G+ GALL++ GAWL+ P AGF+ G LCL WS+L+AR + + + G Sbjct: 1 MLITILSFIIGLAGALLVSAGAWLLLPAAGFITGGVLCLLWSYLIARSVSASAKNNG 57 >UniRef50_B0VK30 Putative prophage protein n=2 Tax=root RepID=B0VK30_9CAUD Length = 59 Score = 40.4 bits (93), Expect = 0.019, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 27/34 (79%) Query: 6 LAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCL 39 L+ L + GA L++YGAWL+Y PAGF+V+GA+ L Sbjct: 14 LSDLCALAGAGLVSYGAWLVYEPAGFIVSGAILL 47 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_C8Q8L1 Putative uncharacterized protein n=1 Tax=Pantoea... 76 4e-13 UniRef50_P75979 Uncharacterized protein ymfR n=19 Tax=root RepID... 71 9e-12 UniRef50_Q6UAX9 Gp3 n=1 Tax=Klebsiella phage phiKO2 RepID=Q6UAX9... 61 1e-08 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_C8Q8L1 Putative uncharacterized protein n=1 Tax=Pantoea sp. At-9b RepID=C8Q8L1_9ENTR Length = 61 Score = 75.8 bits (185), Expect = 4e-13, Method: Composition-based stats. Identities = 36/60 (60%), Positives = 49/60 (81%) Query: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK 60 M+++ILAP++G+LGA L+A+GAW IY PAGF+ AGALCLFWSW V++YL + + GGG Sbjct: 1 MVLIILAPVIGLLGAALIAFGAWQIYEPAGFITAGALCLFWSWAVSQYLSIPRKTSGGGD 60 >UniRef50_P75979 Uncharacterized protein ymfR n=19 Tax=root RepID=YMFR_ECOLI Length = 60 Score = 71.1 bits (173), Expect = 9e-12, Method: Composition-based stats. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK 60 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK Sbjct: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK 60 >UniRef50_Q6UAX9 Gp3 n=1 Tax=Klebsiella phage phiKO2 RepID=Q6UAX9_9CAUD Length = 59 Score = 61.1 bits (147), Expect = 1e-08, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 41/57 (71%) Query: 1 MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVG 57 M++ IL+ ++G+ GALL++ GAWL+ P AGF+ G LCL WS+L+AR + + + G Sbjct: 1 MLITILSFIIGLAGALLVSAGAWLLLPAAGFITGGVLCLLWSYLIARSVSASAKNNG 57 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.322 0.144 0.459 Lambda K H 0.267 0.0446 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 280,761,722 Number of Sequences: 3077464 Number of extensions: 9294424 Number of successful extensions: 47334 Number of sequences better than 1.0e-01: 6 Number of HSP's better than 0.1 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 47323 Number of HSP's gapped (non-prelim): 11 length of query: 60 length of database: 1,040,396,356 effective HSP length: 32 effective length of query: 28 effective length of database: 941,917,508 effective search space: 26373690224 effective search space used: 26373690224 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 87 (38.0 bits)