Return to main results Retrieve Phyre Job Id

Job DescriptionOrphan___
Confidence5.57%DateSun Sep 7 17:02:59 BST 2014
Rank99Aligned Residues28
% Identity36%Templatec3q3wB_
PDB info PDB header:transferaseChain: B: PDB Molecule:3-isopropylmalate dehydratase small subunit; PDBTitle: isopropylmalate isomerase small subunit from campylobacter jejuni.
Resolution1.89 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50.........60.........70........
Predicted Secondary structure 


















Query SS confidence 




































Query Sequence  LGSGNWRGCGSCKVTIYNRGSRESRVTAPKGWAATAV
Query Conservation 




































Alig confidence 










.........
















Template Conservation 



 





.........




  

   




Template Sequence  LVSFENFGSGS. . . . . . . . . SREHAPWALVDYGIRAI
Template Known Secondary structure 
SSBTBSS.........

TTT

Template Predicted Secondary structure 






.........



Template SS confidence 




































   73......80... ......90.........100
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D