Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence99.56%DateWed Nov 27 10:15:14 GMT 2024
Rank122Aligned Residues240
% Identity17%Templatec6v0aD_
PDB info PDB header: oxidoreductaseChain: D: PDB Molecule: nitrite reductase (cytochrome; ammonia-forming); PDBTitle: crystal structure of cytochrome c nitrite reductase from the bacterium2 geobacter lovleyi with bound sulfate
PDB Entry: PDBe RCSB PDBj
Resolution2.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   478.480.........490......... 500 .........510.....
Predicted Secondary structure 



......................






Query Sequence  TVDNSCGACHPKQAAEFIKGRD. H. . . . . . . . . . . . . . . . . . . . . GRPNHPQSWEGNVST
Query Conservation       
  

  
  
      . .....................               
Alig confidence 






.













.
.....................














Template Conservation         .                                       
            
Template Sequence  IDPAVWG. NYPEEYQTWKDTALPTPEGKSKYKKGNDGGKVYDKLSEYPFIALLFNGWGFG
Template Known Secondary structure 


.SSGGGS.B.TTS
SS

TTBTT


BSTTTSGGG
Template Predicted Secondary structure 

.






























   516...520 .........530 .........
Predicted Secondary structure  ....








........




........................
Query Sequence  PWYAE. . . . YYRRGEGYSM. . . . . . . . VGCDQCHQN. . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation 
    ....          ........ 

  



........................
Alig confidence 




....









........








........................
Template Conservation                               
  

                          
Template Sequence  IEYNEPRGHVYMMKDQKEIDPSRLKGGGACLTCKTPYAPQLAQKQGVTYFSQSYADAVNQ
Template Known Secondary structure  T

B



GGGS
TTGGGGGGGGGTTT
TTTS
T
Template Predicted Secondary structure 






























   540.........550......... 560........
Predicted Secondary structure  ........
















.......................



Query Sequence  . . . . . . . . MSSCDDCHSRHRFSAAEARR. . . . . . . . . . . . . . . . . . . . . . . PEACSICHM
Query Conservation  ........ 
 
 





 

  



.......................
 

  


Alig confidence  ........



















.......................








Template Conservation           
 
  

                                      
  

 
Template Sequence  IPKEHQEMGVACIDCHNNKDMGLKISRGFTLVKALDKMGVDQTKLTNQDKRSLVCAQCHV
Template Known Secondary structure  S
GGGTT

S
GGGTB
TTT

B








TT

GGG

TTSS
Template Predicted Secondary structure 







































   569570. ..
Predicted Secondary structure  ......


.................................................

Query Sequence  . . . . . . GPD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HP
Query Conservation  ......


.................................................

Alig confidence  ......


.................................................

Template Conservation                       
                                    
 
Template Sequence  TYTIPKDANMKSQDVFFPWDESKWGKISIENIIKKMRSDKSYGEWTQAVTGFKMAYIRHP
Template Known Secondary structure 

B

B
TT

B


B


TT
BTTB

T
GGG

TTTT





Template Predicted Secondary structure 











































   574..... 580.........590.........600.........610.........620... ......
Predicted Secondary structure 
.































...





Query Sequence  DWESYS. RSKWGVIYETTKERWNWDKNLAEVIPGEDYLAPTCQYCHMYVGN. . . NKWEMN
Query Conservation 
 


 . 



 

       
       
  
 

 








  
 ...   


Alig confidence 





.






........................












...





Template Conservation          
 
   ........................   
  


           
 
Template Sequence  EFEMYSNQSVHWMA. . . . . . . . . . . . . . . . . . . . . . . . GVSCADCHMPYTKVGSKISDHR
Template Known Secondary structure  TT
T........................T

S


SS



Template Predicted Secondary structure 









........................




















   630.........640.........650.........660.........670.........680.........
Predicted Secondary structure 







































Query Sequence  VETKGIWRMGVIPPKEVEFKSGLKDFPYGIKIPPMDKKLEIYSAESQEKRRKWVELCSKC
Query Conservation 
  
  
                   
                 
    
  
  

  
Alig confidence 






.............................................







Template Conservation         .............................................    
  
Template Sequence  IMSPLKN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DFKGCKQC
Template Known Secondary structure 


GGGT.............................................TTTTGGGT
Template Predicted Secondary structure 




.............................................


   690..... ....700.........710.........720..... ....730.........740
Predicted Secondary structure 

.........














Query Sequence  HSSRFA. . . . . . GMWLDSLDQYMFESWRRIDEAQLIIEKLFS. . . ENAIEPPPEKRPPFP
Query Conservation 

  

......       
  
 
      

   
  
  ... 


          
Alig confidence 





......





























...


............
Template Conservation 
                                             
 ............
Template Sequence  HSESSEWLKNQVITIQDRAASQYIRSGYALATVAKLFEMTHKQQAAGK. . . . . . . . . . . .
Template Known Secondary structure 

S
TT
............
Template Predicted Secondary structure 







............
   741........750.........760.........770.........780.........790.. ......
Predicted Secondary structure 














































..
Query Sequence  LSDLIIKVLGAEKLGAEMYRLFKQTNGHLPVIGPILGAYSIFTQNEGNPGGI. . EREYAE
Query Conservation    
                  
       
                   
 
..
     
Alig confidence  ...................................................
..





Template Conservation  ...................................................         
Template Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . QIDQKMYDQ
Template Known Secondary structure  ...................................................


Template Predicted Secondary structure  ...................................................


   799800.........810.........820.........830.........840.........850
Predicted Secondary structure 










Query Sequence  MWFWSHLQGYKGAAHAQPDISWWWGTAQGVGNLTRIRDEAEKLRRLKSGSSS
Query Conservation 

     
   

 
  



 
 
       
  
   
  


   
   
Alig confidence 



















































Template Conservation         
               

       
                   
Template Sequence  AKFYYEEGFYRNLFFGAENSIGFHNPTEAMRILGDATMYAGKADGLLRQALT
Template Known Secondary structure  STTTTTTS
Template Predicted Secondary structure 








Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions