Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence91.14%DateWed Nov 27 10:15:14 GMT 2024
Rank182Aligned Residues94
% Identity19%Templatec1aajA_
PDB info PDB header: electron transportChain: A: PDB Molecule: amicyanin; PDBTitle: crystal structure analysis of amicyanin and apoamicyanin from2 paracoccus denitrificans at 2.0 angstroms and 1.8 angstroms3 resolution
PDB Entry: PDBe RCSB PDBj
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   197..200.........210.........220.........230.........240.........250......
Predicted Secondary structure 


































Query Sequence  AFNNKSGDIELMRGDSSAFPGETWKAKMGDKVRFHLINITEEAHTFHTHGHRWLDKSCDK
Query Conservation    
    
    



   
  

 
  

 






 
   







 
 

    
Alig confidence 





























..



















....



Template Conservation             
                
 ..                    ....    
Template Sequence  AAAEVADGAIVVDIAKMKYETPELHVKVGD. . TVTWINREAMPHNVHFVAGV. . . . LGEA
Template Known Secondary structure  GGGS
TT
TTSSS
TT...
SSS
B


TTT....SSSS
Template Predicted Secondary structure 
















..







....



   257..260.........270.........280.........290.........300.....
Predicted Secondary structure 


















Query Sequence  LIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMVE
Query Conservation   



 
 



 

 
 


   

 






  
   



 
 

Alig confidence 


















.....












....







Template Conservation                     ..... 
           ....  
   
 
Template Sequence  ALKGPMMKKEQAYSLTFTE. . . . . AGTYDYHCTPHPF. . . . MRGKVVVE
Template Known Secondary structure 
...B
TT
S.....

SS
TT....

Template Predicted Secondary structure 












.....





....

Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions