Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence97.33%DateWed Nov 27 10:15:14 GMT 2024
Rank208Aligned Residues86
% Identity16%Templatec6pttA_
PDB info PDB header: electron transport, oxidoreductaseChain: A: PDB Molecule: cytochrome c oxidase subunit 2; PDBTitle: soluble model of arabidopsis thaliana cua (tt3lat)
PDB Entry: PDBe RCSB PDBj
Resolution1.84 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   207..210.........220.........230.........240.........250.........260......
Predicted Secondary structure 





























Query Sequence  LMRGDSSAFPGETWKAKMGDKVRFHLINITEEAHTFHTHGHRWLDKSCDKLIDTIGLNPF
Query Conservation    



   
  

 
  

 






 
   







 
 

     



 
 

Alig confidence 





























.














..........



Template Conservation                                .               ..........    
Template Sequence  YVLAHQWYYQPNPIEVPQGAEIVFKITSAD. VLHGFHVEGTNINVE. . . . . . . . . . VLPG
Template Known Secondary structure  TTSSSTT.SS.S
TTSS
..........
BT
Template Predicted Secondary structure 






.







..........


   267..270.........280......... 290.........300......
Predicted Secondary structure 











.




Query Sequence  DSYVLDFVAGEGVGKGNWAFHCQ. SQEHMMNGMFGIFMVEE
Query Conservation 

 

 
 


   

 





.
  
   



 
 


Alig confidence 










...








.
















Template Conservation             ... 
     
            
   
  
Template Sequence  EVSTVRYTFKR. . . PGEYRIICSEICGTNHAFMFGTIVVKE
Template Known Secondary structure  B


S...


S

STTGGG

Template Predicted Secondary structure 



...









Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions