Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank55Aligned Residues257
% Identity22%Templatec6f5kA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: extracellular laccase, lcc1; PDBTitle: crystal structure of laccase from myceliophthora thermophila
PDB Entry: PDBe RCSB PDBj
Resolution1.62 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.... ..... 50...... ...60... ......70.........80.........90
Predicted Secondary structure 

...





..















Query Sequence  DGAVHLEME. . AKPLT. IEPRPGV. FFDAWGY. CLKGDVPTVPGPVIKVREGTKVKILFR
Query Conservation        
  ..
    . 
  


.    

 .



   








 




 
 
 
Alig confidence 








..




.






.






.


.....


















Template Conservation                                   

 ..... 


 
    

   
   
Template Sequence  GVVRPYTLTTLLTEVDNWTGPDGVVKEKVMLVNNNS. . . . . IIGPTIFADWGDTIQVTVI
Template Known Secondary structure 

..
TTS.TT.B.....SSTT
Template Predicted Secondary structure 

















.....







   91... ... ..100.........110.........120..... ....130.........140......
Predicted Secondary structure 


..

.






















.










Query Sequence  NKLT. . VPA. SIHPHGVKYTTANVGVNIAGNPASIVAP. GDSRIFEWDTAGTPGTWFYHS
Query Conservation 
 
 ..


.






  
   


   
 

  
 
.





 
 

  







Alig confidence 



..


.






.



















.







.











Template Conservation 
 
        

 

 .       

        
 
 
    
  .     

 


 
Template Sequence  NNLEETNGTSSIHWHGL. QKGTNLHDGANGITECPIPPKGGRKVYRF. KAQQYGTSWYHS
Template Known Secondary structure 
S.S

B
.T
.
TT
GGGS

BTTTB..B.TTT.

S
Template Predicted Secondary structure 









.


















.







   147..150.........160. ........170.........180.........190... ......200..
Predicted Secondary structure 









.















...








Query Sequence  YVFERGGEEGLSRGL. WGALIVEPVGGDPNPPDKEFVVFMHAFNVNGQ. . . EYYAFNNKS
Query Conservation 

      


  

. 
 




        


 



 
 
  

...     
   
Alig confidence 

.....







.
















.













...








Template Conservation 
 .....      
   
  

           .       
                  
Template Sequence  HF. . . . . SAQYGNGVVVGAIQINGPASLPYDTD. LGVFPISDYYYSSADELVELTKNSGA
Template Known Secondary structure 
S.....TTGGGGT
.


SS

S.
SS
S..
Template Predicted Secondary structure 

.....


















.











   203......210........ .220.........230.....
Predicted Secondary structure 









.......




....................
Query Sequence  GDIELMRGDSSAFPGE. . . . . . . TWKAKMGDKVRFHLINI. . . . . . . . . . . . . . . . . . . .
Query Conservation   
    



   
  .......

 
  

 






 ....................
Alig confidence 















.......
















....................
Template Conservation         


                   
   
 
 

          
      

  
Template Sequence  PFSDNVLFNGTAKHPETGEGEYANVTLTPGRRHRLRLINTSVENHFQVSLVNHTMTIIAA
Template Known Secondary structure  ..BSTTB
B
TTT

B


.TT


SS

TTB
Template Predicted Secondary structure 




























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation 

    
       
  
 
 

 
       
                           
Template Sequence  DMVPVNAMTVDSLFLGVGQRYDVVIEEASRTPGNYWFNVTFGGGLLCGGSRNPYPAAIFH
Template Known Secondary structure  TTS

TT
.

S.SS

GGGTT

BSSSS
Template Predicted Secondary structure 































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                              
Template Sequence  YAGAPGGPPTDEGKAPVDHNCLDLPNLKPVVARDVPLSGFAKRPDNTLDVTLDTTGTPLF
Template Known Secondary structure  TTS

S

S



....
TT


S


BSS

B


SS



GGG
SSSSS
Template Predicted Secondary structure 


















































   236...240
Predicted Secondary structure  .......................................................




Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TEEAH
Query Conservation  .......................................................
   
Alig confidence  .......................................................




Template Conservation      
                                            
         
Template Sequence  VWKVNGSAINIDWGRPVVDYVLTQNTSFPPGYNIVEVNGADQWSYWLIENDPGAPFTLPH
Template Known Secondary structure  TTB




TTS
TT




GGG

STT

TT
S



Template Predicted Secondary structure 











































   241........250...... ...260.........270...
Predicted Secondary structure 








...........................



Query Sequence  TFHTHGHRWLDKSCDK. . . . . . . . . . . . . . . . . . . . . . . . . . . LIDTIGLNPFDSYVLDF
Query Conservation 






 
 

    ........................... 



 
 



 

 
Alig confidence 















...........................
















Template Conservation 
 



  
 
                                  


 
       

 
Template Sequence  PMHLHGHDFYVLGRSPDESPASNERHVFDPARDAGLLSGANPVRRDVTMLPAFGWVVLAF
Template Known Secondary structure  SSS
S..

TTS






GGG


BS
S
TT
Template Predicted Secondary structure 









































   274.....280.........290.........300........
Predicted Secondary structure 

















Query Sequence  VAGEGVGKGNWAFHCQSQEHMMNGMFGIFMVEEGK
Query Conservation   


   

 






  
   



 
 


  
Alig confidence 



...



























Template Conservation      ...

 
  



  
   

          
Template Sequence  RADN. . . PGAWLFHCHIAWHVSGGLGVVYLERADD
Template Known Secondary structure 

S...
SSTT

Template Predicted Secondary structure 


...







Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions