Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence33.47%DateWed Nov 27 10:15:14 GMT 2024
Rank270Aligned Residues111
% Identity14%Templatec1jmzA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: PDBTitle: crystal structure of a quinohemoprotein amine dehydrogenase2 from pseudomonas putida with inhibitor
PDB Entry: PDBe RCSB PDBj
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   614.....620.........630..... ... .640... ......650 .....
Predicted Secondary structure 













...

..




.






............




Query Sequence  CQYCHMYVGNNKWEMNVETKGI. . . WRM. . GVIPP. KEVEFKS. . . . . . . . . . . . GLKDF
Query Conservation 





  
    



  
  ...
  ..     .       ............     
Alig confidence 





















...


..




.






............




Template Conservation 
  

     
   

   
 


 
   
 

    
  
   
   

 

    

 
Template Sequence  CMGCHIPEGNDTYSRISHQRKTPEGWLMSIARMQVMHGLQISDDDRRTLVKYLADKQGLA
Template Known Secondary structure  BTTB
TTTTGGG






T


Template Predicted Secondary structure 



























   656...660.........670.........680.........690.........700.........710..
Predicted Secondary structure 


















...
Query Sequence  PYGIKIPPMDKKLEIYSAESQEKRRKWVELCSKCHSSRFAGMWLDSLDQYMFESWRR. . .
Query Conservation 
                 
    
  
  

  


  

       
  
 
    ...
Alig confidence 




















..

































...
Template Conservation 
 
        
      
  ..       
  

   
    


  

  
   
   
Template Sequence  PSETDGVRYAMERRLNTVEQF. . DTQLSETCGRCHSGARVALQRRPAKEWEHLVNFHLGQ
Template Known Secondary structure  GGGSTT
TTTTTT
TT




..
SSSS
ST

Template Predicted Secondary structure 
















..





















   713......720......
Predicted Secondary structure  ................
Query Sequence  . . . . . . . . . . . . . . . . IDEAQLIIEKLFSE
Query Conservation  ................  

   
  
   
Alig confidence  ................













Template Conservation   
        
               
   
Template Sequence  WPSLEYQAQARDRDWLPIALQQVVPDLAKR
Template Known Secondary structure 
GGGGGSTTTTTTT




Template Predicted Secondary structure 















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions