Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence99.35%DateWed Nov 27 10:15:14 GMT 2024
Rank137Aligned Residues176
% Identity16%Templatec2rdzA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: cytochrome c-552; PDBTitle: high resolution crystal structure of the escherichia coli cytochrome c2 nitrite reductase.
PDB Entry: PDBe RCSB PDBj
Resolution1.74 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   478.480.........490......... 500.........510
Predicted Secondary structure 



...........................




Query Sequence  TVDNSCGACHPKQAAEFIKGRD. . . . . . . . . . . . . . . . . . . . . . . . . . . HGRPNHPQSWE
Query Conservation       
  

  
  
      ...........................           
Alig confidence 





















...........................










Template Conservation                                   
                   
      
Template Sequence  AKNETFAPQHPDQYLSWKATSEQSERVDALAEDPRLVILWAGYPFSRDYNKPRGHAFAVT
Template Known Secondary structure 

GGGGTTT
GGGG




B
TTTTSGGGT

B



GGG
Template Predicted Secondary structure 

























   511........520.........530.........540. .
Predicted Secondary structure 

















............................
Query Sequence  GNVSTPWYAEYYRRGEGYSMVGCDQCHQNMS. . . . . . . . . . . . . . . . . . . . . . . . . . . . S
Query Conservation       
               

  



 
............................ 
Alig confidence 






























............................
Template Conservation                        
  

                               
 
Template Sequence  DVRETLRTGAPKNAEDGPLPMACWSCKSPDVARLIQKDGEDGYFHGKWARGGPEIVNNLG
Template Known Secondary structure  SGGG


SSTT
SSSBGGGGTTT
T
SSBGGGGTTT

S
S
Template Predicted Secondary structure 












































   543......550...... ...560.........
Predicted Secondary structure 










.............................







....
Query Sequence  CDDCHSRHRFSAAE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . ARRPEACSICHMG. . . .
Query Conservation 
 





 

  
.............................



 

  



....
Alig confidence 













.............................












....
Template Conservation 
  

                                            
  

      
Template Sequence  CADCHNTASPEFAKGKPELTLSRPYAARAMEAIGKPFEKAGRFDQQSMVCGQCHVEYYFD
Template Known Secondary structure  B
TTSTT


B



TT

GGGS
TTTSS

Template Predicted Secondary structure 







































   570.........580.......
Predicted Secondary structure  ..........................................








Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PDHPDWESYSRSKWGVIY
Query Conservation  ..........................................




 


  



 

Alig confidence  ..........................................
















.
Template Conservation              
                               
        
 
   .
Template Sequence  GKNKAVKFPWDDGMKVENMEQYYDKIAFSDWTNSLSKTPMLKAQHPEYETWTAGIHGKN.
Template Known Secondary structure  TTTT


TT
SSTT

S
TTT







ST.
Template Predicted Secondary structure 














































.
   588.590.........600.........610.........620. ........630.........640..
Predicted Secondary structure 

























.....

















Query Sequence  ETTKERWNWDKNLAEVIPGEDYLAPTCQYCHMYV. . . . . GNNKWEMNVETKGIWRMGVIP
Query Conservation         
       
  
 

 








  .....
    



  
  
      
Alig confidence  .......................










.....











.........
Template Conservation  .......................   
  

 
            
     .........
Template Sequence  . . . . . . . . . . . . . . . . . . . . . . . NVTCIDCHMPKVQNAEGKLYTDHKIGNP. . . . . . . . .
Template Known Secondary structure  .......................T

S

TTS






G.........
Template Predicted Secondary structure  .......................



























.........
   643......650.........660.........670.........680.........690.........700..
Predicted Secondary structure 































Query Sequence  PKEVEFKSGLKDFPYGIKIPPMDKKLEIYSAESQEKRRKWVELCSKCHSSRFAGMWLDSL
Query Conservation               
                 
    
  
  

  


  

       
Alig confidence  ....................................












.









Template Conservation  ....................................       
  

 .          
Template Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FDNFAQTCANCHT. QDKAALQKVV
Template Known Secondary structure  ....................................GGGGGGTGGGT

.S
Template Predicted Secondary structure  ....................................

.

   703......710.........720...
Predicted Secondary structure 
Query Sequence  DQYMFESWRRIDEAQLIIEKL
Query Conservation 
  
 
      

   
  
Alig confidence 




















Template Conservation                       
Template Sequence  AERKQSINDLKIKVEDQLVHA
Template Known Secondary structure 
Template Predicted Secondary structure 
Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions