Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank22Aligned Residues261
% Identity26%Templatec6theA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: copper-containing nitrite reductase; PDBTitle: crystal structure of core domain of four-domain heme-cupredoxin-cu2 nitrite reductase from bradyrhizobium sp. ors 375
PDB Entry: PDBe RCSB PDBj
Resolution2.87 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70.........80.........90.
Predicted Secondary structure 

























Query Sequence  LTGKDGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRN
Query Conservation            
  
     
  


    

 



   








 




 
 
 
Alig confidence 


































.....



















Template Conservation                                     .....   
 
    
        
Template Sequence  GKRAPQTVRVDLLSVELEGRLAEGTTFGYWTFNGK. . . . . VPGPLLRVRVGDTVEIHLKN
Template Known Secondary structure 
S...
TTTTB.....BS...TT
Template Predicted Secondary structure 












.....








   92.. .....100.........110.........120.........130.........140.........
Predicted Secondary structure 


..






































Query Sequence  KLT. . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVF
Query Conservation   
 ..









  
   


   
 

  
 






 
 

  









 
Alig confidence 


..










...




....















.












..
Template Conservation                  ...     ....     
 

       .     
       ..
Template Sequence  AADSAMIHSVDFHAAI. . . APGGG. . . . AAALQVEPGGEKAITW. KALVPGLFVYHCA. .
Template Known Secondary structure 
TT

S
B

TT

...SGGGG....GGG

B
TT
.

S


..
Template Predicted Secondary structure 













...




....





.





..
   150.........160.........170.........180.........190... ......200..
Predicted Secondary structure 






















.......








Query Sequence  ERGGEEGLSRGLWGALIVEPVGGDPNPPDKEFVVFMHAFNVNGQ. . . . . . . EYYAFNNKS
Query Conservation       


  

 
 




        


 



 
 
  

.......     
   
Alig confidence 
























.

















.......








Template Conservation            
  
   
       .                                  
Template Sequence  TPMVAEHIANGMYGMILVEPEGGLP. PVDHEFYVMQGEIYSDIPYGQHGSAEFSVEKLLA
Template Known Secondary structure 
SSTT

TT
....
S
BSS.TT


B
Template Predicted Secondary structure 













.























   203......210..... ....220.........230...... ...240.........250.....
Predicted Secondary structure 






...








.











...
Query Sequence  GDIELMRGDSSAF. . . PGETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLDKSCD. . .
Query Conservation   
    



   ...
  

 
  

 






 
.   







 
 

   ...
Alig confidence 












...




















.


















...
Template Conservation         


               
                                  
Template Sequence  ERPEYFVFNGSVGALSKLHPLKAKVGDTVRIFFGVGGPNHASSFHVIGEIFDKVDLFGGL
Template Known Secondary structure  T

STTBTTTBTTTS
TT
SS

T

TTBS
Template Predicted Secondary structure 


































   256...260.........270.........280.........290.........300.........310
Predicted Secondary structure  .....
























Query Sequence  . . . . . KLIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMVEEGKRV
Query Conservation  .....  



 
 



 

 
 


   

 






  
   



 
 


    
Alig confidence  .....





















...





























Template Conservation                 
           ... 
              
             
Template Sequence  TTPPLAGIQTVTVPPGGAAIAEFKVEV. . . PGTYTLVDHALARAERGLLGILHVQGPENP
Template Known Secondary structure  SS..S

TT


S...
S
TTGGGTT

S


T
Template Predicted Secondary structure 
















...
















   311
Predicted Secondary structure 
Query Sequence  N
Query Conservation   
Alig confidence 
Template Conservation   
Template Sequence  D
Template Known Secondary structure  T
Template Predicted Secondary structure 
Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions