Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence32.36%DateWed Nov 27 10:15:14 GMT 2024
Rank288Aligned Residues58
% Identity16%Templatec3isyA_
PDB info PDB header: protein bindingChain: A: PDB Molecule: intracellular proteinase inhibitor; PDBTitle: crystal structure of an intracellular proteinase inhibitor (ipi,2 bsu11130) from bacillus subtilis at 2.61 a resolution
PDB Entry: PDBe RCSB PDBj
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80.........90.........100.........110.........120.........130.....
Predicted Secondary structure 


































Query Sequence  VIKVREGTKVKILFRNKLTVPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDT
Query Conservation 



 




 
 
 
 
 









  
   


   
 

  
 






 
 
Alig confidence 




























.







........













Template Conservation   
 
 
       
    
  
   
   .        ........ 
 

        
Template Sequence  EFQFSTGQKFELVVYDSEHKERYRYSKEK. FTQAFQNL. . . . . . . . TLESGETYDFSDVW
Template Known Secondary structure  SSS


TT

TTTT
.




........
TT



Template Predicted Secondary structure 













.



........



   136 ...140..
Predicted Secondary structure 
..




Query Sequence  A. . GTPGTW
Query Conservation 
..  



Alig confidence 
..





Template Conservation     
  
 
Template Sequence  KEVPEPGTY
Template Known Secondary structure  SS


S
Template Predicted Secondary structure 






Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions