Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank84Aligned Residues260
% Identity20%Templatec1kyaB_
PDB info PDB header: oxidoreductaseChain: B: PDB Molecule: laccase; PDBTitle: active laccase from trametes versicolor complexed with 2,5-xylidine
PDB Entry: PDBe RCSB PDBj
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   40.........50.........60.........70.........80.........90....
Predicted Secondary structure 
























.....
Query Sequence  HLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKLT. . . . .
Query Conservation    
  
     
  


    

 



   








 




 
 
 
 
 .....
Alig confidence 













.











.....






















.....
Template Conservation                .            ..... 


      
        
        
Template Sequence  VADLTITNAAVSPD. GFSRQAVVVNGG. . . . . TPGPLITGNMGDRFQLNVIDNLTNHTML
Template Known Secondary structure 
TT.S

TTB.....SB...TT.



GGG
Template Predicted Secondary structure 


.



.....














   95....100.........110.........120.........130.........140.........150....
Predicted Secondary structure 










































Query Sequence  VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFERGGE
Query Conservation 









  
   


   
 

  
 






 
 

  









      
Alig confidence 





















































.....
Template Conservation       
 

         
           

    
        
   

 
 ..... 
Template Sequence  KSTSIHWHGFFQKGTNWADGPAFINQCPISSGHSFLYDFQVPDQAGTFWYHSHL. . . . . S
Template Known Secondary structure  S
B
T


TT
GGGS

BTTTB..B.TT

S


S.....T
Template Predicted Secondary structure 



































.....
   155....160.........170....... ..180.........190.........200.........210
Predicted Secondary structure 











....

















Query Sequence  EGLSRGLWGALIVEPVGGDPNPP. . . . DKEFVVFMHAFNVNGQEYYAFNNKSGDIELMRG
Query Conservation 


  

 
 




        ....


 



 
 
  

     
    
    

Alig confidence 






















....
































Template Conservation       
  
  

                                             

Template Sequence  TQYCDGLRGPFVVYDPNDPAADLYDVDNDDTVITLVDWYHVAAKLGPAFPLGADATLING
Template Known Secondary structure  TTTTTT

TT
TTGGG
SB
SGGG
SS
TTTS
SS

S
STT
Template Predicted Secondary structure 






































   211... .....220.........230.....
Predicted Secondary structure 



.....








..............................
Query Sequence  DSSA. . . . . FPGETWKAKMGDKVRFHLINI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation 

  ..... 
  

 
  

 






 ..............................
Alig confidence 



.....




















..............................
Template Conservation                     
   
 
  
                  
  

    
   
Template Sequence  KGRSPSTTTADLSVISVTPGKRYRFRLVSLSCDPNYTFSIDGHNMTIIETDSINTAPLVV
Template Known Secondary structure  B


TT
TTS...
TT


SS

TT

TT
Template Predicted Secondary structure 
































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation         
 
    
                                             
Template Sequence  DSIQIFAAQRYSFVLEANQAVDNYWIRANPNFGNVGFTGGINSAILRYDGAAAVEPTTTQ
Template Known Secondary structure  SB
TT


S.SSSSSS
S
GGGTTTT

SS





Template Predicted Secondary structure 


































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                
             
Template Sequence  TTSTAPLNEVNLHPLVATAVPGSPVAGGVDLAINMAFNFNGTNFFINGASFTPPTVPVLL
Template Known Secondary structure 


SSB

GGG

BSS

..SS
SSTT
SS


SS
TTB




SS
Template Predicted Secondary structure 





































   236...240.........250..
Predicted Secondary structure  .....................................









......
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TEEAHTFHTHGHRWLDK. . . . . .
Query Conservation  .....................................
   







 
 

......
Alig confidence  .....................................
















......
Template Conservation                                           

 



  
 
       
Template Sequence  QIISGAQNAQDLLPSGSVYSLPSNADIEISFPATAAAPGAPHPFHLHGHAFAVVRSAGST
Template Known Secondary structure  TT

STTTSSSTTS
SS




TTS
S
S
SS


TT

Template Predicted Secondary structure 




































   253......260..... ....270.........280.........290.........300.....
Predicted Secondary structure  ....





...
















Query Sequence  . . . . SCDKLIDTIGLNP. . . FDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMVE
Query Conservation  ....     



 
 
...


 

 
 


   

 






  
   



 
 

Alig confidence  ....












...











...
























Template Conservation            

                    ... 
    


   
   

       
Template Sequence  VYNYDNPIFRDVVSTGTPAAGDNVTIRFRTDN. . . PGPWFLHCHIDFHLEAGFAVVFAED
Template Known Secondary structure 


SSS

S


TTTT




S...
S
TTT
S
Template Predicted Secondary structure 
























...





   306...310...
Predicted Secondary structure 





Query Sequence  EGKRVNAV
Query Conservation 
       
Alig confidence 







Template Conservation          
Template Sequence  IPDVASAN
Template Known Secondary structure  S
Template Predicted Secondary structure 




Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions