Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank28Aligned Residues307
% Identity21%Templatec6iqzA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: bilirubin oxidase; PDBTitle: high resolution structure of bilirubin oxidase from myrothecium2 verrucaria - wild type
PDB Entry: PDBe RCSB PDBj
Resolution1.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50..... ....60.........70.........80.........90.
Predicted Secondary structure 








.
















Query Sequence  TGKDGAVHLEMEAKPLTIEPRPG. VFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRN
Query Conservation           
  
     
  

.
    

 



   








 




 
 
 
Alig confidence 






















.










.....



















Template Conservation                                  

 ..... 


 
    
    
   
Template Sequence  VNGQEIWYYEVEIKPFTHQVYPDLGSADLVGYDGM. . . . . SPGPTFQVPRGVETVVRFIN
Template Known Secondary structure  TT



STTS

TT
.....SSTT

Template Predicted Secondary structure 















.....






   92.......100.........110.........120.........130.........140.........150.
Predicted Secondary structure 











































Query Sequence  KLTVPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFER
Query Conservation   
 









  
   


   
 

  
 






 
 

  









   
Alig confidence 




















.....

































Template Conservation          
 

       

.....       

    
        

  

 
    
Template Sequence  NAEAPNSVHLHGSFSRAAFDG. . . . . WAEDITEPGSFKDYYYPNRQSARTLWYHDHAMHI
Template Known Secondary structure 
SSS
B
T



GGGTT.....
TT

B
TT


S.S

TTT
Template Predicted Secondary structure 


















.....























   152.......160.........170....... . .180.........190.....
Predicted Secondary structure 













....
.







...........
Query Sequence  GGEEGLSRGLWGALIVEPVGGDPNPP. . . . D. KEFVVFMHAFNVNGQEY. . . . . . . . . . .
Query Conservation     


  

 
 




        ....
.

 



 
 
  

  ...........
Alig confidence 


.





















....
.
















...........
Template Conservation     .    
  
  

                                            
Template Sequence  TAE. NAYRGQAGLYMLTDPAEDALNLPSGYGEFDIPMILTSKQYTANGNLVTTNGELNSF
Template Known Secondary structure  .TT

TT

S
TBTTT
B
TTS.B..
TT

S

Template Predicted Secondary structure 


.


































   196...200.....
Predicted Secondary structure  ..................................................








Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . YAFNNKSGDI
Query Conservation  ..................................................   
    
 
Alig confidence  ..................................................









Template Conservation        


             
 
 

                        

  

  
Template Sequence  WGDVIHVNGQPWPFKNVEPRKYRFRFLDAAVSRSFGLYFADTDAIDTRLPFKVIASDSGL
Template Known Secondary structure 

STTS

SS

SS

TTSTTS...TT
Template Predicted Secondary structure 





























   206.
Predicted Secondary structure  ..........................................................
Query Sequence  EL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation    ..........................................................
Alig confidence 

..........................................................
Template Conservation     
       
  
 
  
                                        
Template Sequence  LEHPADTSLLYISMAERYEVVFDFSDYAGKTIELRNLGGSIGGIGTDTDYDNTDKVMRFV
Template Known Secondary structure  S

TT
GGGGTT

TT




BTTTT
Template Predicted Secondary structure 




































   208.210......... 220..
Predicted Secondary structure  .........................................







....
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MRGDSSAFPGET. . . . WKA
Query Conservation  ......................................... 



   
  
....
 
Alig confidence  .........................................











....


Template Conservation                                             


              
Template Sequence  VADDTTQPDTSVVPANLRDVPFPSPTTNTPRQFRFGRTGPTWTINGVAFADVQNRLLANV
Template Known Secondary structure 
SS
SS






S





....

S..TTTTB
TT
TTT
Template Predicted Secondary structure 















































   223......230........ .240.........250...... ...260........
Predicted Secondary structure 







.










.............



Query Sequence  KMGDKVRFHLINITEE. AHTFHTHGHRWLDKSCDK. . . . . . . . . . . . . LIDTIGLNPFDS
Query Conservation    

 






 
  . 







 
 

    ............. 



 
 



Alig confidence 















.

















.............











Template Conservation    
      
 
      

 



  
 
                    


       
Template Sequence  PVGTVERWELINAGNGWTHPIHIHLVDFKVISRTSGNNARTVMPYESGLKDVVWLGRRET
Template Known Secondary structure  TT



SS

SS

TT





GGGSS
BS
TT
Template Predicted Secondary structure 






































   269270.... .....280.........290.........300......... 310.........320.....
Predicted Secondary structure  .


















..









Query Sequence  YVLDFV. AGEGVGKGNWAFHCQSQEHMMNGMFGIFMVEEGKR. . VNAVIASCDEGRKTLS
Query Conservation   

 
 .


   

 






  
   



 
 


   ..                
Alig confidence 





.


...




























..




.









Template Conservation    
       ... 
    


   
   

     
            .          
Template Sequence  VVVEAHYAPF. . . PGVYMFHCHNLIHEDHDMMAAFNATVLPDYGYNATV. FVDPMEELWQ
Template Known Secondary structure 

S
...
S
TT


TT

TTGGG.TS
TT
GGGS
Template Predicted Secondary structure 


...
























.









   326...330. ........340.........350......
Predicted Secondary structure 





.......















Query Sequence  APGQDR. . . . . . . QPPTLEGFSGAYMYPEITEKNMYES
Query Conservation        .......                         
Alig confidence 





.......











..










Template Conservation                           ..           
Template Sequence  ARPYELGEFQAQSGQFSVQAVTERI. . QTMAEYRPYAA
Template Known Secondary structure 


T
GGGS..T
TTGG
Template Predicted Secondary structure 
















..





Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions