Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank29Aligned Residues255
% Identity25%Templatec4ystA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: nitrite reductase; PDBTitle: structure of copper nitrite reductase from geobacillus2 thermodenitrificans - 24.9 mgy
PDB Entry: PDBe RCSB PDBj
Resolution1.34 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70.........80.........90.
Predicted Secondary structure 

























Query Sequence  LTGKDGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRN
Query Conservation            
  
     
  


    

 



   








 




 
 
 
Alig confidence 


































.....



















Template Conservation                         
           ..... 


 
    
        
Template Sequence  ERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQ. . . . . APGPLVVVNEGDTIHFTLKN
Template Known Secondary structure  TTTTTTB.....SS


TT
Template Predicted Secondary structure 












.....







   92... ....100.........110.........120.........130.........140.........150
Predicted Secondary structure 



.






































Query Sequence  KLTV. PASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFE
Query Conservation   
 
.








  
   


   
 

  
 






 
 

  









  
Alig confidence 



.















........















.













Template Conservation              
        ........      
         .   
          
Template Sequence  MDPVVPHSMDFHAVHASPSKD. . . . . . . . FIDVMPNKSGTFTYPA. NKPGVFMYHCGTKP
Template Known Secondary structure 

SS

B

TTS


........S

B
TT
.
S


.SS
Template Predicted Secondary structure 


















........





.







   151........160.........170..... ....180.........190.........200........
Predicted Secondary structure 












..



















Query Sequence  RGGEEGLSRGLWGALIVEPVGGDPN. . PPDKEFVVFMHAFNVNGQEYYAFNNKSGDIELM
Query Conservation      


  

 
 




      ..  


 



 
 
  

     
    
    
Alig confidence  ..






















..

















.













Template Conservation  ..       
  
   
                            .              
Template Sequence  . . VLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYND. MNDFQNGVPSYVVF
Template Known Secondary structure  ..TT

TT

TTGGG


STT
.S..S
Template Predicted Secondary structure  ..























.




   209210.........220.........230...... ...240.........250.....
Predicted Secondary structure  ............













.











Query Sequence  . . . . . . . . . . . . RGDSSAFPGETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLDKSCD
Query Conservation  ............



   
  

 
  

 






 
.   







 
 

   
Alig confidence  ............



























.


















Template Conservation              

              
        
                     
Template Sequence  SSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLD
Template Known Secondary structure 

SSTT




SBSSS
TT.SS

TT

T
Template Predicted Secondary structure 


































   256 ...260.........270.........280.........290.........300......
Predicted Secondary structure 
.......



















Query Sequence  K. . . . . . . LIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMVEE
Query Conservation   ....... 



 
 



 

 
 


   

 






  
   



 
 


Alig confidence 
.......




















...

























Template Conservation                   
           ... 
              
         
Template Sequence  GNPNNHLQGMQTVMLPASGGAVVEFTVTR. . . PGTYPIVTHQFNHAQKGAVAMLKVTE
Template Known Secondary structure  T
TTSS

TT


S...SSSTT

Template Predicted Secondary structure 

















...








Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions