Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence97.62%DateWed Nov 27 10:15:14 GMT 2024
Rank145Aligned Residues93
% Identity26%Templatec6y7eB_
PDB info PDB header: oxidoreductaseChain: B: PDB Molecule: nitrous-oxide reductase; PDBTitle: pseudomonas stutzeri nitrous oxide reductase mutant, h494a
PDB Entry: PDBe RCSB PDBj
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   207..210.........220.........230...... ...240.........250.........260...
Predicted Secondary structure 













...












Query Sequence  LMRGDSSAFPGETWKAKMGDKVRFHLINIT. . . EEAHTFHTHGHRWLDKSCDKLIDTIGL
Query Conservation    



   
  

 
  

 






 
...   







 
 

     



 
Alig confidence 





























...















..........
Template Conservation                    
  
                           .......... 
Template Sequence  YMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSME. . . . . . . . . . I
Template Known Secondary structure  TTS

TT



STT

TTTT..........
Template Predicted Secondary structure 


















..........
   264.....270.........280.........290.... .....300.........310..
Predicted Secondary structure 















.








Query Sequence  NPFDSYVLDFVAGEGVGKGNWAFHCQSQEHM. MNGMFGIFMVEEGKRVNA
Query Conservation   



 

 
 


   

 






  
 .  



 
 


      
Alig confidence 













...













.

















Template Conservation                ... 
     
          
     
        
Template Sequence  SPQQTSSITFVADK. . . PGLHWYYCSWFCHALHMEMVGRMMVEPAWSHPQ
Template Known Secondary structure 
TT


S...


S

STTGGG

GGGS

Template Predicted Secondary structure 






...


















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions