Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank34Aligned Residues262
% Identity24%Templatec5ytmA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: copper-containing nitrite reductase; PDBTitle: c135a mutant of copper-containing nitrite reductase from geobacillus2 thermodenitrificans determined by in-ouse source
PDB Entry: PDBe RCSB PDBj
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40. ........50.........60.........70.........80........
Predicted Secondary structure 



..





















Query Sequence  CLTGKDGAVHL. . EMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKIL
Query Conservation             ..
  
     
  


    

 



   








 




 
 
Alig confidence 










..
























.....
















Template Conservation                
                     
 ..... 


 
    

     
Template Sequence  ERVGPHDVVHIEEMMTAQITDIEIDKGKIYKAWTFNGQ. . . . . APGPLVVVNEGDTIHFT
Template Known Secondary structure  TT...TTTTB.....SS


TT
Template Predicted Secondary structure 












.....








   8990.. ... ....100.........110.........120.........130.........140......
Predicted Secondary structure 
.


.


































Query Sequence  FRNK. LTV. PASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHS
Query Conservation 
 
 .
 
.








  
   


   
 

  
 






 
 

  







Alig confidence 



.


.

















........
























Template Conservation    
             
          ........    
             
      
Template Sequence  LKNMMDPVVPHSMDFHAVHASPSKDFI. . . . . . . . DVMPNKSGTFTYPANNKPGVFMYHA
Template Known Secondary structure 
.
SS

B

TTS


S
........
B
TT

.S

Template Predicted Secondary structure 


















........













   147..150.........160.........170..... ....180.........190.........200....
Predicted Secondary structure 
















..



















Query Sequence  YVFERGGEEGLSRGLWGALIVEPVGGDPN. . PPDKEFVVFMHAFNVNGQEYYAFNNKSGD
Query Conservation 

      


  

 
 




      ..  


 



 
 
  

     
    
Alig confidence 



..






















..




























Template Conservation      ..       
  
   
                                       
Template Sequence  GTKP. . VLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQQNGVPS
Template Known Secondary structure 
.SS..TT

TT

TTGGG


STT
.S

S
Template Predicted Secondary structure 



..




























   205... .210.........220.........230...... ...240.........250.
Predicted Secondary structure  ............













.







Query Sequence  IELM. . . . . . . . . . . . RGDSSAFPGETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLD
Query Conservation      ............



   
  

 
  

 






 
.   







 
 
Alig confidence 



............



























.














Template Conservation                  

              
        
                  
Template Sequence  YVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDD
Template Known Secondary structure 

SSTT




SBSSS
TT
SS

TT

Template Predicted Secondary structure 
































   252..... ..260.........270.........280.........290.........300...
Predicted Secondary structure 




........


















Query Sequence  KSCDKL. . . . . . . . IDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFM
Query Conservation 
     ........



 
 



 

 
 


   

 






  
   



 
 
Alig confidence 





........



















...






















Template Conservation                        
           ... 
              
      
Template Sequence  VYLDGNPNNHHLQGMQTVMLPASGGAVVEFTVTR. . . PGTYPIVTHQFNHAQKGAVAMLK
Template Known Secondary structure  TT
TTS.S

TT


S...SSSTT
Template Predicted Secondary structure 



















...






   304.....310
Predicted Secondary structure 




Query Sequence  VEEGKRV
Query Conservation 


    
Alig confidence 






Template Conservation         
Template Sequence  VTETGED
Template Known Secondary structure  SSS

Template Predicted Secondary structure 




Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions