Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank82Aligned Residues260
% Identity20%Templatec5b7eA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: blue copper oxidase cueo; PDBTitle: structure of perdeuterated cueo
PDB Entry: PDBe RCSB PDBj
Resolution1.42 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.........70.........80.........90.....
Predicted Secondary structure 



























Query Sequence  DGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKLTV
Query Conservation        
  
     
  


    

 



   








 




 
 
 
 
 
Alig confidence 






















.






.....























Template Conservation                         .    
  ..... 


 
    
  
 
   
 
  
Template Sequence  DARNRIQLTIGAGQSTFGGKTAT. TWGYNGN. . . . . LLGPAVKLQRGKAVTVDIYNQLTE
Template Known Secondary structure 
TTSTT.SSS.....SB

TT

SSS
Template Predicted Secondary structure 












.


.....











   96...100.........110.........120.........130.........140.........150.....
Predicted Secondary structure 









































Query Sequence  PASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFERGGEE
Query Conservation 








  
   


   
 

  
 






 
 

  









      
Alig confidence 
















.....
































.



Template Conservation      
 

       

.....     
 

    
        
   

 
   .    
Template Sequence  ETTLHWHGLEVPGEVDG. . . . . GPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHG. KTGR
Template Known Secondary structure 
B

T



GGGS
.....
TT

B
TT


S
S


TT.T
Template Predicted Secondary structure 










.....




















.
   156...160.........170....... ..180.........190.
Predicted Secondary structure 











.....




...................
Query Sequence  GLSRGLWGALIVEPVGGDPNPP. . . . . DKEFVVFMHAFNVN. . . . . . . . . . . . . . . . . . .
Query Conservation 

  

 
 




        .....


 



 
 
  ...................
Alig confidence 





















.....













...................
Template Conservation      

 
  

                                                
Template Sequence  QVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWF
Template Known Secondary structure  T


TT



BTTT
B
TTSSB



S


Template Predicted Secondary structure 










































   192.......200......
Predicted Secondary structure  .......................................












......
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GQEYYAFNNKSGDIE. . . . . .
Query Conservation  .......................................

     
    
  ......
Alig confidence  .......................................














......
Template Conservation        

               
 

                      

     
   
Template Sequence  GDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKV
Template Known Secondary structure 
STTS


SS

TT


TT
Template Predicted Secondary structure 



























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation         
 
                                                  
Template Sequence  SELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGAL
Template Known Secondary structure  S

TT

SS





STTTTSTTTTS





Template Predicted Secondary structure 

































   207..210....
Predicted Secondary structure  ....................................................



Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LMRGDSSA
Query Conservation  ....................................................  



  
Alig confidence  ....................................................







Template Conservation                                                          

  
Template Sequence  PDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGDFHHANKINGQA
Template Known Secondary structure 
S




.....
TT

GGGGGSSSGGG
TTB
Template Predicted Secondary structure 
















































   215 ....220.........230...... ...240.........250.... .....260..
Predicted Secondary structure 
..








.










.........

Query Sequence  F. . PGETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLDKSC. . . . . . . . . DKLIDTIG
Query Conservation   ..
  

 
  

 






 
.   







 
 

  .........   



 
Alig confidence 
..




















.

















.........







Template Conservation              
        
      

 



  
 
                

  
Template Sequence  FDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVK
Template Known Secondary structure 

TT

STT


TT



TT

BBTTB...GGGSSSBS
Template Predicted Secondary structure 





































   263.. ....270...... ...280.........290.........300.........310
Predicted Secondary structure 

.



..

















Query Sequence  LNP. FDSYVLDFVAG. . EGVGKGNWAFHCQSQEHMMNGMFGIFMVEEGKRV
Query Conservation 
 
.


 

 
 

..
   

 






  
   



 
 


    
Alig confidence 


.










..
...





























Template Conservation                    ... 
    


   
   

     
      
Template Sequence  VEGNVSEVLVKFNHDAPK. . . EHAYMAHCHLLEHEDTGMMLGFTVSAWSHP
Template Known Secondary structure  SSS


S
B
G...GG
SSTT
S


T
Template Predicted Secondary structure 







...



















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions