Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank64Aligned Residues277
% Identity20%Templatec5lduA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: laccase a; PDBTitle: recombinant high-redox potential laccase from basidiomycete trametes2 hirsuta
PDB Entry: PDBe RCSB PDBj
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.........90....
Predicted Secondary structure 
























....
Query Sequence  VHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKLT. . . .
Query Conservation     
  
     
  


    

 



   








 




 
 
 
 
 ....
Alig confidence 














.











.....






















....
Template Conservation                 .            ..... 


      
        
       
Template Sequence  PVADLTITDAAVSPD. GFSRQAVVVNGV. . . . . TPGPLVAGNIGDRFQLNVIDNLTNHTM
Template Known Secondary structure  S
TT.S

TTB.....SS...TT.



GGG
Template Predicted Secondary structure 



.



.....















   95....100.........110.........120.........130.........140.........150...
Predicted Secondary structure  .










































Query Sequence  . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFERGG
Query Conservation  .









  
   


   
 

  
 






 
 

  









     
Alig confidence  .





















































.....
Template Conservation        
 

                      
    
        
   
    .....
Template Sequence  LKSTSIHWHGFFQHGTNWADGPAFINQCPISPGHSFLYDFQVPDQAGTFWYHSHL. . . . .
Template Known Secondary structure 
S
B
T


TT
GGGS

BTTTB..B.TT

SS


S.....
Template Predicted Secondary structure 



































.....
   154.....160.........170....... ..180.........190.........200.........
Predicted Secondary structure 











....

















Query Sequence  EEGLSRGLWGALIVEPVGGDPNPP. . . . DKEFVVFMHAFNVNGQEYYAFNNKSGDIELMR
Query Conservation   


  

 
 




        ....


 



 
 
  

     
    
    
Alig confidence 























....































Template Conservation        
  
  

                                            

Template Sequence  STQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPLGADATLIN
Template Known Secondary structure  TTGGGGT

TT
TTGGG
SB
SGGG
SS
TTTS
SS
SS
ST
Template Predicted Secondary structure 







































   210........ .220.........230......
Predicted Secondary structure 







.....





............................
Query Sequence  GDSSAFPGE. . . . . TWKAKMGDKVRFHLINIT. . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation 


   
  .....

 
  

 






 
............................
Alig confidence 








.....

















............................
Template Conservation 
                   
   
 
  
                     

    
  
Template Sequence  GKGRAPSDTTAELSVIKVTKGKRYRFRLVSLSCDPNHTFSIDGHNLTIIEVDSVNSQPLE
Template Known Secondary structure  TB


TT
TTS...
TT


SS

TT

TT
Template Predicted Secondary structure 


























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation       
  
 
 
  
                                            
Template Sequence  VDSIQIFAAQRYSFVLDANQAVDNYWIRANPNFGNVGFDGGINSAILRYDGAPAVEPTTN
Template Known Secondary structure  SB
TT


S
SSSSSS
S
GGGTTTTS
SS




Template Predicted Secondary structure 


































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                

            
Template Sequence  QTTSVKPLNEVDLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPTVPVL
Template Known Secondary structure  ....SSB

GGG

BSS

..SS
SSTT
SS


SS
TTB




SS
Template Predicted Secondary structure 








































   237..240.........250..
Predicted Secondary structure  .......................................








.....
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . EEAHTFHTHGHRWLDK. . . . .
Query Conservation  .......................................   







 
 

.....
Alig confidence  .......................................















.....
Template Conservation                                            

 



  
 
      
Template Sequence  LQILSGAQTAQDLLPSGSVYVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGS
Template Known Secondary structure  TT

STTTSSSTTS
TT


TTS
S.S.TT


TT
Template Predicted Secondary structure 






































   253......260..... ....270.........280.........290.........300....
Predicted Secondary structure  .....





...
















Query Sequence  . . . . . SCDKLIDTIGLNP. . . FDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMV
Query Conservation  .....     



 
 
...


 

 
 


   

 






  
   



 
 
Alig confidence  .....












...











...























Template Conservation             

                    ... 
    


   
   

     
Template Sequence  TVYNYDNPIFRDVVSTGTPAAGDNVTIRFDTNN. . . PGPWFLHCHIDFHLEGGFAVVMAE
Template Known Secondary structure 



SSS..S


GGGT


S...
SSTT
Template Predicted Secondary structure 

























...







   305... .310.........320.........
Predicted Secondary structure 


.....














Query Sequence  EEGK. . . . . RVNAVIASCDEGRKTLSAPGQ
Query Conservation 

  .....                     
Alig confidence 



.....




















Template Conservation                                
Template Sequence  DTPDVKAVNPVPQAWSDLCPTYDALDPNDQ
Template Known Secondary structure 




TTS
GGG
Template Predicted Secondary structure 

















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions