Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence97.98%DateWed Nov 27 10:15:14 GMT 2024
Rank140Aligned Residues108
% Identity24%Templatec6btmA_
PDB info PDB header: membrane proteinChain: A: PDB Molecule: PDBTitle: structure of alternative complex iii from flavobacterium johnsoniae2 (wild type)
PDB Entry: PDBe RCSB PDBj
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   460.........470......... 480.........490 .........500.
Predicted Secondary structure 















.

.................
Query Sequence  GVYCSYCHGSDHEKLFMPTV. DNSCGACHPKQ. . . . . . . . . . . . . . . . . AAEFIKGRDHG
Query Conservation   
 
  

   
        .   
  

  
.................  
        
Alig confidence 



















.










.................










Template Conservation     
  

                
  

                               
Template Sequence  EINCKYCHSAARVSKTAGIPSLNVCMNCHKNISEVAETTATAEYSKAFYDAQIQKLYDAV
Template Known Secondary structure 


S
TTTTSS

....TTSTTS

S

SSS

SS

Template Predicted Secondary structure 









































   502 .......510.........520.........530 .........540
Predicted Secondary structure 
..........













.





..........
Query Sequence  R. . . . . . . . . . PNHPQSWEGNVSTPWYAEYYRRGEGYSM. VGCDQCHQNM. . . . . . . . . .
Query Conservation   ..........             
              . 

  



 ..........
Alig confidence 
..........



























.









..........
Template Conservation                                    
       
  

             
Template Sequence  GWDKTKQAYTGKTQPVKWVRIHNLPDFVYFNHSQHVSVAGVECQTCHGPVQEFEIMKQYS
Template Known Secondary structure  TTTTT
S













TT



SSTTTTSS


TTTTT

GGG
SS



S
Template Predicted Secondary structure 
















































   541........550. .. ......560. ......
Predicted Secondary structure  ....










........

.....


..........


Query Sequence  . . . . SSCDDCHSRHR. . . . . . . . FS. . . . . AAEARRPE. . . . . . . . . . ACSICH
Query Conservation  ....
 
 





 ........

.....  




 ..........

  

Alig confidence  ....










........

.....







..........





Template Conservation        
  

                
                     
  

Template Sequence  KLTMGWCVDCHRKTDVKMEGNAYYEKIHAELSKKYGVEKLTAAQMGGLECGKCH
Template Known Secondary structure 

SSSST
B


SS
STTSSSTTTT
S

BTT


TTTS
Template Predicted Secondary structure 






























Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions