Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence44.49%DateWed Nov 27 10:15:14 GMT 2024
Rank272Aligned Residues70
% Identity16%Templatec3e1zA_
PDB info PDB header: hydrolase inhibitor/hydrolaseChain: A: PDB Molecule: PDBTitle: crystal structure of the parasite protesase inhibitor chagasin in2 complex with papain
PDB Entry: PDBe RCSB PDBj
Resolution1.86 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   74.....80.........90.........100. ........110.........120.......
Predicted Secondary structure 










......
























Query Sequence  GPVIKVREGTKVKILFRNKLTVPASIHP. . . . . . HGVKYTTANVGVNIAGNPASIVAPGD
Query Conservation 





 




 
 
 
 
 






......


  
   


   
 

  
 


Alig confidence 



























......






.

















Template Conservation     
 
  
    
 
     


 
               .              
   
Template Sequence  GATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMF. TVENKYFPPDSKLLGAGG
Template Known Secondary structure  T

TT.
GGGT
BTTTBSS
S
TTT.

S


TT

Template Predicted Secondary structure 






















.












   128.130.........140.....
Predicted Secondary structure 







Query Sequence  SRIFEWDTAGTPGTWFYH
Query Conservation 



 
 

  






Alig confidence 






.









Template Conservation       
 .
   
   
 
Template Sequence  TEHFHVT. VKAAGTHAVN
Template Known Secondary structure  .
SS
Template Predicted Secondary structure  .



Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions