Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence95.69%DateWed Nov 27 10:15:14 GMT 2024
Rank175Aligned Residues111
% Identity16%Templatec4lmhD_
PDB info PDB header: electron transportChain: D: PDB Molecule: extracellular iron oxide respiratory system surface PDBTitle: crystal structure of the outer membrane decaheme cytochrome omca
PDB Entry: PDBe RCSB PDBj
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   456...460.........470..... ....480.........490.........500.........510...
Predicted Secondary structure 















..










Query Sequence  GTKDGVYCSYCHGSDHEKLF. . MPTVDNSCGACHPKQAAEFIKGRDHGRPNHPQSWEGNV
Query Conservation       
 
  

   
    ..       
  

  
  
                    
Alig confidence 



















..





































Template Conservation   

    
  

       

        
  

                  

 

   
Template Sequence  NVVSIQACYTCHQPESLALHGGRRIDIENCASCHTATSGDPESGNSIEFTYMIHAIHKGG
Template Known Secondary structure 



TTT

GGGG
BGGGTB

S
TTBB
TTT

B

GG
Template Predicted Secondary structure 


















































   514.... .520.... .....530.......
Predicted Secondary structure 

....................


.








...............
Query Sequence  STPWY. . . . . . . . . . . . . . . . . . . . AEYYRR. GEGYSMVGCDQCH. . . . . . . . . . . . . . .
Query Conservation    
  ....................      .       

  

...............
Alig confidence 




....................





.












...............
Template Conservation                                    
    

  

               
Template Sequence  ERHTFDATGAQVPAPYKIIGYGGKVIDYGKVHYPQKPAADCAACHVEGAGAPANADLFKA
Template Known Secondary structure  G

SS





GGG
GGG




BSTT
GGGT


STT

TTGGGGGS
Template Predicted Secondary structure 

















































   538.540.........550.........560.........
Predicted Secondary structure  .























Query Sequence  . QNMSSCDDCHSRHRFSAAEARRPEACSICHMG
Query Conservation  .

 
 
 





 

  




 

  



Alig confidence  .











...
















Template Conservation   
    
 


  ...     
    
  

  
Template Sequence  DLSNQACIGCHTE. . . KPSAHHSSTDCMACHNA
Template Known Secondary structure 


S
S...

STT




S
S
Template Predicted Secondary structure 








...













Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions