Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence99.44%DateWed Nov 27 10:15:14 GMT 2024
Rank133Aligned Residues180
% Identity17%Templatec2rdzD_
PDB info PDB header: oxidoreductaseChain: D: PDB Molecule: cytochrome c-552; PDBTitle: high resolution crystal structure of the escherichia coli cytochrome c2 nitrite reductase.
PDB Entry: PDBe RCSB PDBj
Resolution1.74 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   478.480.........490.........500 .........510
Predicted Secondary structure 



...........................




Query Sequence  TVDNSCGACHPKQAAEFIKGRDH. . . . . . . . . . . . . . . . . . . . . . . . . . . GRPNHPQSWE
Query Conservation       
  

  
  
       ...........................          
Alig confidence 






















...........................









Template Conservation       
  

                                                  
Template Sequence  AKNETFAPQHPDQYLSWKATSEQSERVDALAEDPRLVILWAGYPFSRDYNKPRGHAFAVT
Template Known Secondary structure 

GGGGTTT
GGGG




B
TTTTSGGGT

B



GGG
Template Predicted Secondary structure 

























   511........520.........530.........540. .
Predicted Secondary structure 

















............................
Query Sequence  GNVSTPWYAEYYRRGEGYSMVGCDQCHQNMS. . . . . . . . . . . . . . . . . . . . . . . . . . . . S
Query Conservation       
               

  



 
............................ 
Alig confidence 






























............................
Template Conservation                        
  

                               
 
Template Sequence  DVRETLRTGAPKNAEDGPLPMACWSCKSPDVARLIQKDGEDGYFHGKWARGGPEIVNNLG
Template Known Secondary structure  SGGG


SSTT
SSSBGGGGTTT
TSSBTTT

S
S
Template Predicted Secondary structure 












































   543......550........ .560.........570
Predicted Secondary structure 












..............................






..
Query Sequence  CDDCHSRHRFSAAEAR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RPEACSICHMGP. .
Query Conservation 
 





 

  


..............................

 

  




..
Alig confidence 















..............................











..
Template Conservation 
  

                                             
  

     
Template Sequence  CADCHNTASPEFAKGKKPELTLSRPYAARAMEAIGKPFEKAGRFDQQSMVCGQCHVEYYF
Template Known Secondary structure  B
TTSTT
.

B



TT

GGGS
TTTSS

Template Predicted Secondary structure 

































   571........580......
Predicted Secondary structure  ............................................







Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DHPDWESYSRSKWGVI
Query Conservation  ............................................



 


  



 
Alig confidence  ............................................














.
Template Conservation                                               
          
  .
Template Sequence  DGKNKAVKFPWDDGMKVENMEQYYDKIAFSDWTNSLSKTPMLKAQHPEYETWTAGIHGK.
Template Known Secondary structure  TTTT


TT
SSTT

S
TTT







S.
Template Predicted Secondary structure 














































.
   587..590.........600.........610 .........620. ........630.........640
Predicted Secondary structure 




















.




.....















Query Sequence  YETTKERWNWDKNLAEVIPGEDYL. APTCQYCHMYV. . . . . GNNKWEMNVETKGIWRMGV
Query Conservation 
       
       
  
 

 .








  .....
    



  
  
    
Alig confidence  .......................
.










.....













.....
Template Conservation  .......................     
  



            
       .....
Template Sequence  . . . . . . . . . . . . . . . . . . . . . . . NNNVTCIDCHMPKVQNAEGKLYTDHKIGNPFD. . . . .
Template Known Secondary structure  .......................TT.

S

TTS




S
GGG.....
Template Predicted Secondary structure  .......................































.....
   641........650.........660.........670.........680... ......690.........
Predicted Secondary structure 






























.


Query Sequence  IPPKEVEFKSGLKDFPYGIKIPPMDKKLEIYSAESQEKRRKWV. ELCSKCHSSRFAGMWL
Query Conservation                 
                 
    
  
 . 

  


  

    
Alig confidence  ........................................


.















Template Conservation  ........................................      
  

         
Template Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NFAQQTCANCHTQDDKAALQ
Template Known Secondary structure  ........................................GGGG.TGGGT

S
.
Template Predicted Secondary structure  ........................................








   700.........710 .........720......
Predicted Secondary structure  .
Query Sequence  DSLDQYMFESW. RRIDEAQLIIEKLFSE
Query Conservation     
  
 
  .    

   
  
   
Alig confidence 










.















Template Conservation                              
Template Sequence  KVVAERKQSINDDLKIKVEDQLVHAHFE
Template Known Secondary structure  .
Template Predicted Secondary structure 
Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions