Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank46Aligned Residues260
% Identity22%Templatec2yqbA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: copper-containing nitrite reductase; PDBTitle: structure of p93a variant of three-domain heme-cu nitrite reductase2 from ralstonia pickettii at 1.4 a resolution
PDB Entry: PDBe RCSB PDBj
Resolution1.41 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   32.......40.........50.........60.........70.........80.........90.
Predicted Secondary structure 

























Query Sequence  LTGKDGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRN
Query Conservation            
  
     
  


    

 



   








 




 
 
 
Alig confidence 


































.....



















Template Conservation                                     .....   
      
        
Template Sequence  NRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGT. . . . . VPGSFIRVRQGDTVEFHLKN
Template Known Secondary structure 

SS

TTSSS.....SS

BTT
Template Predicted Secondary structure 












.....








   92.. .....100.........110.........120.........130.........140.........
Predicted Secondary structure 


..






































Query Sequence  KLT. . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVF
Query Conservation   
 ..









  
   


   
 

  
 






 
 

  









 
Alig confidence 


..














.......
















.














Template Conservation                      .......         
       .     
         
Template Sequence  HPSSKMAHNIDLHGVTGPGG. . . . . . . GAASSFTAPGHESQFTF. KALNEGIYVYHCATA
Template Known Secondary structure 
TT
SS
B

TT

SGGG.......GGGG

B
TT
.

S



S
Template Predicted Secondary structure 














.......







.







   150.........160.........170.........180.........190... ......200..
Predicted Secondary structure 






















.......








Query Sequence  ERGGEEGLSRGLWGALIVEPVGGDPNPPDKEFVVFMHAFNVNGQ. . . . . . . EYYAFNNKS
Query Conservation       


  

 
 




        


 



 
 
  

.......     
   
Alig confidence  ..



















.




















.......








Template Conservation  ..        
  
   
    .                                     
Template Sequence  . . PVGMHIANGMYGLILVEPPE. GLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAID
Template Known Secondary structure  ..STT

TT.
...
S
BSS.TT

..B
T
Template Predicted Secondary structure  ..








.






















   203......210...... ...220.........230...... ...240.........250......
Predicted Secondary structure 







...







.












..
Query Sequence  GDIELMRGDSSAFP. . . GETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLDKSCDK. .
Query Conservation   
    



   
...  

 
  

 






 
.   







 
 

    ..
Alig confidence 













...



















.



















..
Template Conservation          
                
        
                         
Template Sequence  ERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGT
Template Known Secondary structure  T

STTSTTTTSGGG
TT
SS

T

TT
S
Template Predicted Secondary structure 

































   257..260.........270.........280.........290.... .....300.........310
Predicted Secondary structure  ....















.







Query Sequence  . . . . LIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHM. MNGMFGIFMVEEGKRV
Query Conservation  .... 



 
 



 

 
 


   

 






  
 .  



 
 


    
Alig confidence  ....




















...













.















Template Conservation                           ... 
                             
Template Sequence  NVQKNVQTTLIPAGGAAVVKFTARV. . . PGSYVLVDHSIFRAFNKGAMAILKIDGAENK
Template Known Secondary structure 

S
TT


S...
SSS

S


T
Template Predicted Secondary structure 













...










Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions