Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank62Aligned Residues234
% Identity24%Templatec9bxaA_
PDB info PDB header: metal transportChain: A: PDB Molecule: PDBTitle: structure of mnx h340a complex from bacillus sp. pl-12
PDB Entry: PDBe RCSB PDBj
Resolution3.37 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72.......80.........90.........100........ .110.........120.........130
Predicted Secondary structure 


















.


















Query Sequence  VPGPVIKVREGTKVKILFRNKLTVPASIHPHGVKYTT. ANVGVNIAGNPASIVAPGDSRI
Query Conservation 







 




 
 
 
 
 









  
 .  


   
 

  
 





Alig confidence 




































.





















Template Conservation            

   
   
        
 

         
            

    
Template Sequence  VQPLAIRANEGDIVEILFENQLSFSAGMHFQEADYSVLSSDGADAGYNPDTTVEPGGEIL
Template Known Secondary structure 
S
TT

SSS
B

B

S
B


SS

TT...

B
TT
Template Predicted Secondary structure 








































   131........140.........150.... .....160.........170........
Predicted Secondary structure 















.












...........
Query Sequence  FEWDTAGTPGTWFYHSYVFERGGE. EGLSRGLWGALIVEPVGGDPNPPD. . . . . . . . . . .
Query Conservation 
 
 

  









      .


  

 
 




        
...........
Alig confidence 


.



















.























...........
Template Conservation 
  .     
    
               

 
 


                      
Template Sequence  YRL. NVNQEGICFFTDLGNVSSTEQGSSVQGLFGALLVQKRGSSWTDPVTGGPINSGVYA
Template Known Secondary structure  .

S
B

S


SSTT
SGGGS


TT

SSS



SS
S
Template Predicted Secondary structure  .







































   179180....... ..190.........200.........210.....
Predicted Secondary structure  ..........

....



















.........
Query Sequence  . . . . . . . . . . KEFVVFMHA. . . . FNVNGQEYYAFNNKSGDIELMRGDSSAF. . . . . . . . .
Query Conservation  ..........

 



 
.... 
  

     
    
    



   .........
Alig confidence  ..........








....



























.........
Template Conservation             
      
                           
             
Template Sequence  DIHHPFLPSFREYAWFFNDEMEIRDLTGERPLNPMTNQEAESFHGVNLRYEPMTNRKRLM
Template Known Secondary structure 
SSS





B
TTSS

TTTT..

TTB


Template Predicted Secondary structure 








































   216...220.........230...... ...240.........250
Predicted Secondary structure  ........................








.







Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . PGETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWL
Query Conservation  ........................
  

 
  

 






 
.   







 
 
Alig confidence  ........................




















.













Template Conservation                                   
                     
    
Template Sequence  EAGVVCPDCDSEEVHHDSWVFGDPATPILRGYVGDPAVIRLIHGGVKETHVFHYHVHQWL
Template Known Secondary structure  TT
S
SS

SSTTSSB


SS

TT



SS

TT

Template Predicted Secondary structure 












































   251... .....260.........270.... .....280.........290.........300.
Predicted Secondary structure 


...





......














Query Sequence  DKSC. . . DKLIDTIGLNPFDSYVLDFV. . . . . . AGEGVGKGNWAFHCQSQEHMMNGMFGI
Query Conservation 

  ...   



 
 



 

 
 ......


   

 






  
   



 
Alig confidence 



...



















......


...




















Template Conservation                                      ... 
              
    
Template Sequence  GDSSNINAEILDAQSISPQTHYSIQPLYGLGSLHGA. . . IGDSIIHCHLYPAFGIGMWGM
Template Known Secondary structure  S
SS
SSS
S
SS

TTSTTTTTT
...
S
T
Template Predicted Secondary structure 

























...










   302.......
Predicted Secondary structure 



Query Sequence  FMVEEGKR
Query Conservation 
 


   
Alig confidence 







Template Conservation    
     
Template Sequence  NRVFDTLQ
Template Known Secondary structure 

S

Template Predicted Secondary structure 



Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions