Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence98.13%DateWed Nov 27 10:15:14 GMT 2024
Rank162Aligned Residues97
% Identity20%Templatec6l9sA_
PDB info PDB header: metal binding proteinChain: A: PDB Molecule: blue (type 1) copper domain protein; PDBTitle: crystal structure of na-dithionite reduced auracyanin from2 photosynthetic bacterium roseiflexus castenholzii
PDB Entry: PDBe RCSB PDBj
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   207..210... ......220.........230......... 240.........250.
Predicted Secondary structure 


..













.




............
Query Sequence  LMRGDSS. . AFPGETWKAKMGDKVRFHLINITEEA. HTFHTHGHRWLD. . . . . . . . . . . .
Query Conservation    



 ..  
  

 
  

 






 
   .







 
 
............
Alig confidence 






..

























.











............
Template Conservation                      
                                       
Template Sequence  EIASDGENLAYDKKEFTVPTGQTITVTFKNTSTAQQHNIVIVKGGEDVAAKVDEEAINAG
Template Known Secondary structure  B
TTSSSBS
STTS


SS

B

SSS
Template Predicted Secondary structure 






















   252.......260.........270.........280.........290.........300....
Predicted Secondary structure  .......























Query Sequence  . . . . . . . KSCDKLIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMV
Query Conservation  .......
     



 
 



 

 
 


   

 






  
   



 
 
Alig confidence  .......

























...























Template Conservation                                   ... 
              
      
Template Sequence  PPDFLPADRTNIIAATKMLGPGGSETITFTAPA. . . PGTYVFLCTYPAHYAGGMKGVMTV
Template Known Secondary structure  TTT


SS
TT


B.TT


S...S

STTTTTTT
Template Predicted Secondary structure 





















...






   305.
Predicted Secondary structure 
Query Sequence  EE
Query Conservation 

Alig confidence 

Template Conservation    
Template Sequence  AP
Template Known Secondary structure 
Template Predicted Secondary structure 
Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions