Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence63.97%DateWed Nov 27 10:15:14 GMT 2024
Rank262Aligned Residues35
% Identity31%Templatec1w7oA_
PDB info PDB header: electron transportChain: A: PDB Molecule: cytochrome c3; PDBTitle: cytochrome c3 from desulfomicrobium baculatus
PDB Entry: PDBe RCSB PDBj
Resolution1.81 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   533.... . .540..... ....550.. .......560 .......
Predicted Secondary structure 

......
.






..






.......



..


Query Sequence  CDQCH. . . . . . Q. NMSSCDD. . CHSRHRF. . . . . . . SAAEARRP. . EACSICH
Query Conservation 
  

......
.
 
 
 
..




 
.......
  




.. 

  

Alig confidence 




......
.






..






.......







..






Template Conservation 
  


           
    

                   
 
  
  

Template Sequence  CAQCHHTLEADGGAVKKCTTSGCHDSLEFRDKANAKDIKLVENAYHTQCIDCH
Template Known Secondary structure  STTTTTTTT....TTSTTSS


...
TTTTT
TTS
Template Predicted Secondary structure 






































Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions