Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence93.45%DateWed Nov 27 10:15:14 GMT 2024
Rank189Aligned Residues84
% Identity20%Templatec3erxA_
PDB info PDB header: electron transportChain: A: PDB Molecule: pseudoazurin; PDBTitle: high-resolution structure of paracoccus pantotrophus pseudoazurin
PDB Entry: PDBe RCSB PDBj
Resolution1.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   215....220.........230.........240.........250.........260.........270....
Predicted Secondary structure 


























Query Sequence  FPGETWKAKMGDKVRFHLINITEEAHTFHTHGHRWLDKSCDKLIDTIGLNPFDSYVLDFV
Query Conservation   
  

 
  

 






 
   







 
 

     



 
 



 

 
 
Alig confidence 





















........





























Template Conservation    
       
  
        ........                              
Template Sequence  FEPAFVRAEPGDVINFVPTDKS. . . . . . . . HNVEAIKEILPEGVESFKSKINESYTLTVT
Template Known Secondary structure  SS
TTSSTT........



TTSS
TT...
B..TT


Template Predicted Secondary structure 










........


















   275....280.........290.........300...... ...310...
Predicted Secondary structure 















.




Query Sequence  AGEGVGKGNWAFHCQSQEHMMNGMFGIFMVEE. GKRVNAV
Query Conservation 


   

 






  
   



 
 


.       
Alig confidence 
.....









..













.






Template Conservation   ..... 
        ..       
   
          
Template Sequence  E. . . . . PGLYGVKCTP. . HFGMGMVGLVQVGDAPENLDAA
Template Known Secondary structure  S.....

GG..GTTTT
SSS
TT
Template Predicted Secondary structure 
.....



..










Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions