Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank61Aligned Residues268
% Identity21%Templatec7zn6A_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: laccase-like multicopper oxidase 1; PDBTitle: crystal structure of laccase-like multicopper oxidase (lmco) from2 thermothelomyces thermophilus
PDB Entry: PDBe RCSB PDBj
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   38.40.........50.........60.........70.........80.........90... ...
Predicted Secondary structure 























.


Query Sequence  AVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKL. TVP
Query Conservation      
  
     
  


    

 



   








 




 
 
 
 
. 

Alig confidence 




























.....





















.


Template Conservation                            
  ..... 


 
    
    
   
 
    
Template Sequence  IPDHILRVSVAQVPSACENNREDVVVNGT. . . . . SPGPAIHLLPGARTWIRVYNDMNDRN
Template Known Secondary structure 

STT.TTB.....SS



TT


SS

Template Predicted Secondary structure 













.....













   97..100.... .....110.........120.........130...... ...140.........150...
Predicted Secondary structure 

..
























.













Query Sequence  ASIHPHGV. . KYTTANVGVNIAGNPASIVAPGDSRIFEWDTA. GTPGTWFYHSYVFERGG
Query Conservation 







..  
   


   
 

  
 






 
 

.  









     
Alig confidence 







..








..




















.
















Template Conservation     
 

         

 ..       
  
    
         
    
 
      
Template Sequence  LSMHWHGLSQRFAPFSDGT. . PSATQWPIPPGHFFDYEILTEPEDAGTYFYHSHVGMQAL
Template Known Secondary structure  B

T


TT
GGGS

..BTTTB..B.TT


TT



STTGGG
Template Predicted Secondary structure 













..






















   154.....160.........170.........180.........190...
Predicted Secondary structure 


















....................
Query Sequence  EEGLSRGLWGALIVEPVGGDPNPPDKEFVVFMHAFNVNGQ. . . . . . . . . . . . . . . . . . . .
Query Conservation   


  

 
 




        


 



 
 
  

....................
Alig confidence 
.....

































....................
Template Conservation   .....
    


                                              
Template Sequence  S. . . . . CTGPPLIVEDCGSSPYHYDDERILLFQDHFQKSDLEMIQGLTSTQFTWTGETRG
Template Known Secondary structure  T.....S.

SS

SS

S

SS
SSS




S
S
Template Predicted Secondary structure 
.....





























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation    


                                               
   
 
 
Template Sequence  ILLNGRGVSPNQAAVQGRPGEASGFFGSHRFRGDDQIEPPTDCTLPVIDVEPGKTYRLRF
Template Known Secondary structure  TT

TT



.B.SS
SSTTTT

SSSGGGS....SSS




TT
Template Predicted Secondary structure 











































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation   
                   
  

     
       
  
 
 

            
Template Sequence  IGATGLSLLTMGFEDHNDLTIVQVDGSEYNAPVTVDHIQLGGGQRFDVLLRTKTAEELRC
Template Known Secondary structure 

SS
TTB

TTTS

TT
...
Template Predicted Secondary structure 






























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                              
Template Sequence  NGDKTTYFLQFETRDRPDPYRGYGVLRYNLGTPVPAAPTTPALTLPAEVNNWLEYTFQPL
Template Known Secondary structure  TTS

SSSS

S
TTS.B....SS
SS


S

TTSSSS


BS
Template Predicted Secondary structure 









































   194.....200.........210........
Predicted Secondary structure  ...................


















................
Query Sequence  . . . . . . . . . . . . . . . . . . . EYYAFNNKSGDIELMRGDSSAFPGE. . . . . . . . . . . . . . . .
Query Conservation  ...................     
    
    



   
  ................
Alig confidence  ...................
























................
Template Conservation                                      
                       
Template Sequence  HPSSSLSPTAEEVTRRVILEAEQKIDPATGRLVWKLAHMTWTDMSRDKPVLVDIYERGEE
Template Known Secondary structure  SGGG

...TTT


TTT

TTB


TTS
SS
GG.
Template Predicted Secondary structure 








































   219220.........230....... ..240.........
Predicted Secondary structure  ....................






.........






Query Sequence  . . . . . . . . . . . . . . . . . . . . TWKAKMGDKVRFHLINITE. . . . . . . . . EAHTFHTHGHRW
Query Conservation  ....................

 
  

 






 
 .........  







 
Alig confidence  ....................


















.........











Template Conservation                            
                       

 



  
Template Sequence  AAMPDYAAALTNYGWDPATKLFPAKKDEVLEIVIQNTGSHYSGASGIVETHPFHAHGQHF
Template Known Secondary structure  GGS

TTTTS
TTT


TT
B


TTSTTB


SSS.
Template Predicted Secondary structure 










































   250.. .......260... ......270.......
Predicted Secondary structure 
.....................



...........






Query Sequence  LDK. . . . . . . . . . . . . . . . . . . . . SCDKLIDTIGL. . . . . . . . . . . NPFDSYVLDFVAGE
Query Conservation   

.....................     



 
........... 



 

 
 


Alig confidence 


.....................










...........













Template Conservation   
                            

                            
Template Sequence  YDVGSGPGKYDPEANNAKLASLGYRRPIKRDTTMVYRYGEGKVAPGEPAGWRAWRMKMNN
Template Known Secondary structure  SSS

T

.

S


TTSB
SBT



Template Predicted Secondary structure 






































   278.280.........290.........300.........310.........320
Predicted Secondary structure 






















Query Sequence  GVGKGNWAFHCQSQEHMMNGMFGIFMVEEGKRVNAVIASCDEG
Query Conservation     

 






  
   



 
 


              
Alig confidence  ...







































Template Conservation  ... 
    


   
   

     
                
Template Sequence  . . . PGVWMVHCHILAHMIMGMETIWVVGDAEDIVTIPLSVSQN
Template Known Secondary structure  ...
S
TT
S
TS


B
GG
Template Predicted Secondary structure  ...

















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions