Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence96.87%DateWed Nov 27 10:15:14 GMT 2024
Rank163Aligned Residues89
% Identity22%Templatec6qycB_
PDB info PDB header: electron transportChain: B: PDB Molecule: decaheme c-type cytochrome, omca/mtrc family; PDBTitle: crystal structure of mtrc from shewanella baltica os185
PDB Entry: PDBe RCSB PDBj
Resolution2.29 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   456...460.........470 .........480......... 490.........500....
Predicted Secondary structure 










....










.......



Query Sequence  GTKDGVYCSYCHGSD. . . . HEKLFMPTVDNSCGACHPK. . . . . . . QAAEFIKGRDHGRPN
Query Conservation       
 
  

   ....
           
  

  .......
  
           
Alig confidence 














....







..








.......














Template Conservation         
  

       
       ..  
  

               
  
     
Template Sequence  KIVATESCNTCHQDLANVKHGGAYSDV. . NYCATCHTAGKVGVGKEFNVLVHAKHKDLTL
Template Known Secondary structure 



S
GGGSSGGG



..SSBTTB
TT
STT


Template Predicted Secondary structure 



















..




















   505....510.........520.........530....... ..540.........
Predicted Secondary structure 














...............











Query Sequence  HPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCH. . . . . . . . . . . . . . . QNMSSCDDCHSR
Query Conservation             
               

  

...............

 
 
 




Alig confidence 

.......................







...............











Template Conservation    .......................   
  

                    
 


  
Template Sequence  GS. . . . . . . . . . . . . . . . . . . . . . . LESCQSCHAANDAAPDWGNWSRIPTAATCGSCHST
Template Known Secondary structure  GG.......................GGSGGGT



TT
TTTT


STT
Template Predicted Secondary structure 

.......................


























   550.... .....560.........
Predicted Secondary structure 



....







Query Sequence  HRFSA. . . . AEARRPEACSICHMG
Query Conservation 
 

 .... 




 

  



Alig confidence 




....














Template Conservation          
        
  

  
Template Sequence  VDFAAGKGHSQQLDNSNCIACHNS
Template Known Secondary structure 
BTTTTBSS


SSSSSS
Template Predicted Secondary structure 




















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions