Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence83.56%DateWed Nov 27 10:15:14 GMT 2024
Rank233Aligned Residues82
% Identity16%Templatec1kdjA_
PDB info PDB header: electron transferChain: A: PDB Molecule: plastocyanin; PDBTitle: oxidized form of plastocyanin from dryopteris crassirhizoma
PDB Entry: PDBe RCSB PDBj
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   215....220.........230.........240.........250....... ..260.......
Predicted Secondary structure 






















.......



Query Sequence  FPGETWKAKMGDKVRFHLINITEEAHTFHTHGHRWLDKSCDKL. . . . . . . IDTIGLNPFD
Query Conservation   
  

 
  

 






 
   







 
 

     .......



 
 


Alig confidence 













..


























.......









Template Conservation            
   ..                                            
Template Sequence  FYPDSITVSAGEAV. . EFTLVGETGHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEP
Template Known Secondary structure  SS
TT

..
SSS
B

...TT

TS

TT

BBTTB
Template Predicted Secondary structure 






..


































   268.270.........280.........290.........300.....
Predicted Secondary structure 














Query Sequence  SYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMVE
Query Conservation 
 

 
 


   

 






  
   



 
 

Alig confidence 







.....








..













Template Conservation          ..... 
       ..        
     
Template Sequence  SFKAKVST. . . . . PGTYTFYCT. . PHKSANMKGTLTVK
Template Known Secondary structure 


S.....

S..TTGGGT

Template Predicted Secondary structure 

.....

..







Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions