Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence89.75%DateWed Nov 27 10:15:14 GMT 2024
Rank212Aligned Residues86
% Identity17%Templatec4dp0A_
PDB info PDB header: electron transportChain: A: PDB Molecule: PDBTitle: the 1.5 angstrom crystal structure of oxidized (cuii) poplar2 plastocyanin b at ph 4.0
PDB Entry: PDBe RCSB PDBj
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   211........ 220.........230.........240.........250. ...... ..
Predicted Secondary structure 







..













.




........
Query Sequence  DSSAFPGET. . WKAKMGDKVRFHLINITEEAHTFHTHGHRWLD. KSCDKL. . . . . . . . ID
Query Conservation 

   
  
..
 
  

 






 
   







 
 
.
     ........

Alig confidence 








..






..






















.

..

........

Template Conservation                  
 ..                          ..            
Template Sequence  GSLAFVPSEEFSSVPAGE. . KIVFKNNAGFPHNVLFDEDAVPSSGV. . DVSSKISMSSEE
Template Known Secondary structure  S


SS..
TT
..
SSS
B


TTSS
T.T
..
GG.GGS

.TT
Template Predicted Secondary structure 











..













..











   260.........270.........280.........290.........300.....
Predicted Secondary structure 


















Query Sequence  TIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGIFMVE
Query Conservation 

 
 



 

 
 


   

 






  
   



 
 

Alig confidence 















.....
























Template Conservation                  ..... 
                       
Template Sequence  DLLNAKGETFEVALSD. . . . . KGEYTFYCSSPHQQGAGMVGKVIVN
Template Known Secondary structure 

B
STT


S.....

T.TTG.GGT

Template Predicted Secondary structure 







.....











Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions