Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank25Aligned Residues261
% Identity25%Templatec1kbvD_
PDB info PDB header: oxidoreductaseChain: D: PDB Molecule: major outer membrane protein pan 1; PDBTitle: nitrite-soaked crystal structure of the soluble domain of ania from2 neisseria gonorrhoeae
PDB Entry: PDBe RCSB PDBj
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70.........80.........90...
Predicted Secondary structure 



























Query Sequence  GKDGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKL
Query Conservation          
  
     
  


    

 



   








 




 
 
 
 
Alig confidence 
































.....





















Template Conservation                                   ..... 
 
 
    
        
  
Template Sequence  DYPAKVRVKMETVEKTMKMDDGVEYRYWTFDGD. . . . . VPGRMIRVREGDTVEVEFSNNP
Template Known Secondary structure 
S

TTTTB.....SS..BTT

T
Template Predicted Secondary structure 










.....








   94 .....100.........110.........120.........130.........140.........150.
Predicted Secondary structure 
..








































Query Sequence  T. . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFER
Query Conservation   ..









  
   


   
 

  
 






 
 

  









   
Alig confidence 
..










...




....















.














..
Template Conservation             
  ...     ....        
       .     
         ..
Template Sequence  SSTVPHNVDFHAAT. . . GQGGG. . . . AAATFTAPGRTSTFSF. KALQPGLYIYHCAVA. .
Template Known Secondary structure  T
SS
B

TT

...SGGGG....TTTT
B
TT
.

S


.S..
Template Predicted Secondary structure 







...




....






.








..
   152.......160.........170.........180.........190. ........200....
Predicted Secondary structure 


















.......












Query Sequence  GGEEGLSRGLWGALIVEPVGGDPNPPDKEFVVFMHAFNVN. . . . . . . GQEYYAFNNKSGD
Query Conservation     


  

 
 




        


 



 
 
  .......

     
    
Alig confidence 



















.


















.......












Template Conservation          
  
   
    .                                       
Template Sequence  PVGMHIANGMYGLILVEPKE. GLPKVDKEFYIVQGDFYTKGKKGAQGLQPFDMDKAVAEQ
Template Known Secondary structure  STT

TT.




S
BSS.TT

..B
T
Template Predicted Secondary structure 






.




























   205....210........ .220.........230...... ...240.........250.....
Predicted Secondary structure 







...





.











.....
Query Sequence  IELMRGDSSAFPGE. . . TWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLDKSCD. . . . .
Query Conservation      



   
  ...

 
  

 






 
.   







 
 

   .....
Alig confidence 













...

















.


















.....
Template Conservation        

               
                                    
Template Sequence  PEYVVFNGHVGALTGDNALKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLI
Template Known Secondary structure 
STTSTTTTSGGG
TTSS

TT

BSGGGSS
Template Predicted Secondary structure 





























   256...260.........270.........280.........290.... .....300.........310...
Predicted Secondary structure  .
















.








Query Sequence  . KLIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHM. MNGMFGIFMVEEGKRVNAV
Query Conservation  .  



 
 



 

 
 


   

 






  
 .  



 
 


       
Alig confidence  .





















...













.


















Template Conservation             
           ... 
                                
Template Sequence  NENVQSTIVPAGGSAIVEFKVDI. . . PGNYTLVDHSIFRAFNKGALGQLKVEGAENPEIM
Template Known Secondary structure 
SBS
TT
S...
SSTSS
S


TTT
Template Predicted Secondary structure 









...




















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions