Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence99.59%DateWed Nov 27 10:15:14 GMT 2024
Rank24Aligned Residues367
% Identity18%Templatec4rknA_
PDB info PDB header: unknown functionChain: A: PDB Molecule: mcca; PDBTitle: wolinella succinogenes octaheme sulfite reductase mcca, form ii
PDB Entry: PDBe RCSB PDBj
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   345....350.........360.........370.........380.........390.........400....
Predicted Secondary structure 





































Query Sequence  YPEITEKNMYESFAGLEKGDGIWGDYYSPIPLYTYFNPSRHYVPPESDAYTNLLVKYRPD
Query Conservation                      
             
  
   
                  
Alig confidence 








































.




.............
Template Conservation                                           . 
   .............
Template Sequence  WIEEGRGNDFSKASKRSGGEGFSSMMYRVARNSTLQYPNKF. IGPEK. . . . . . . . . . . . .
Template Known Secondary structure 


GGGS
GGGGTS



S


SS

TTSSS


.

.............
Template Predicted Secondary structure 


























.


.............
   405....410.........420.........430.
Predicted Secondary structure 










.................................
Query Sequence  QCVECHEETTPGIVAEWKMSNHANPKK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation   

 

   




 

  
 

    .................................
Alig confidence  .




....
















.................................
Template Conservation  .
  

....      
  
 
                                      
Template Sequence  . CGECH. . . . PAQYETWSRSRHATTIRFPGEHPEVNNKLNDPVFDKDTASILPQGITPDV
Template Known Secondary structure  .
....TSS
TT

GGGTT
SSS
SSSTTS

SS.TT

GGG
Template Predicted Secondary structure  .
....








































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                              
Template Sequence  VYCTVGHIRTKFGFFDAWLLRGTYHVEGGLLKNGTGQIVAGGNQWQRTWALNLSPEVAKK
Template Known Secondary structure 
TTSTT
BB

SS
GGGT
SS








Template Predicted Secondary structure 



























   432.......440......
Predicted Secondary structure  ...........................................








..
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NPHVSAETQEIEALI. .
Query Conservation  ...........................................               ..
Alig confidence  ...........................................














..
Template Conservation                                              
  

           
Template Sequence  IKKWVPDFPVTLEEYGDNGGYVRGLASYAAKYKKSMSFQASTSYCEVCHPWKFDFKNESE
Template Known Secondary structure  STT


SGGGGGGG

SSTT
SSTTT
BGGGTS


SS
Template Predicted Secondary structure 



















































   447..450.........460......... 470.........480.........490......
Predicted Secondary structure  .....


















.











....
Query Sequence  . . . . . GKELNNWRPGTKDGVYCSYCHGS. DHEKLFMPTVDNSCGACHPKQAAEFIK. . . .
Query Conservation  .....              
 
  

  . 
           
  

  
  
   ....
Alig confidence  .....






















.


























....
Template Conservation                     
 

 


               
  

             
Template Sequence  FYAALGNAKELQKHTISKGVSCEECHGAGGHLEGGSGLLISNCERCHQRFSYSPDLMRNN
Template Known Secondary structure  TT
TSS

TTTTSTTS






S


T
Template Predicted Secondary structure 




















































   497..500.........510.........520.........530........ .540..
Predicted Secondary structure  ..



















............



Query Sequence  . . GRDHGRPNHPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCHQ. . . . . . . . . . . . NMSS
Query Conservation  ..                   
               

  


............
 
 
Alig confidence  ..














....................






............



Template Conservation                   .................... 
  

        
        
Template Sequence  PLNAGKPDLALSSKFKS. . . . . . . . . . . . . . . . . . . . MGPGCGSEGSQTYFTAHYEKGMR
Template Known Secondary structure  GGGTT
GGGG
T....................TBTT
TSTT

Template Predicted Secondary structure 
















....................






















   543......550...... ...560.........570........
Predicted Secondary structure 










........................












Query Sequence  CDDCHSRHRFSAAE. . . . . . . . . . . . . . . . . . . . . . . . ARRPEACSICHMGPDHPDWESY
Query Conservation 
 





 

  
........................



 

  








 


Alig confidence 













........................












....




Template Conservation 
  

  
                                    
  

  ....     
Template Sequence  CATCHDPHDVTGNVTGEKGIKGVSYNSEQGYLSSLYSKPKLKKECTDCHKE. . . . QAYIQ
Template Known Secondary structure  B
SS

S
S



TT


SS

TTSGGGG
S




BS


....
Template Predicted Secondary structure 










































....

   579580.........590.........600.........610.........620.... ..
Predicted Secondary structure 
































............

Query Sequence  SRSKWGVIYETTKERWNWDKNLAEVIPGEDYLAPTCQYCHMYVGNN. . . . . . . . . . . . KW
Query Conservation    



 

       
       
  
 

 








  
  ............  
Alig confidence 





.........................














............

Template Conservation        .........................    
  

                    
Template Sequence  SKADTH. . . . . . . . . . . . . . . . . . . . . . . . . SKNSCASCHMPFMMSCENFYAIQFQDQAG
Template Known Secondary structure  TSSSTT.........................TTS
S


BBSS

GGG
BGGGTB
Template Predicted Secondary structure 





.........................




























   627..630.........640.........650.........660.........670.........680......
Predicted Secondary structure 









































Query Sequence  EMNVETKGIWRMGVIPPKEVEFKSGLKDFPYGIKIPPMDKKLEIYSAESQEKRRKWVELC
Query Conservation 



  
  
                   
                 
    
  
  

Alig confidence 



















......

































Template Conservation         
            ......                                 
Template Sequence  FDTQRRAHIWKIDVDPARKS. . . . . . LVAGSTSKDPRDGKDWHFERNEEGRNFVDLMWAC
Template Known Secondary structure  S


B





B


SS

S......

TT
SSTTS

S



TTS


B
Template Predicted Secondary structure 













......





























   687..690..... ....700.........710.........
Predicted Secondary structure  .............


..............
Query Sequence  . . . . . . . . . . . . . SKCHSSRFA. . . . . . . . . . . . . . GMWLDSLDQYMFESWRRIDEAQLI
Query Conservation  .............  


  

..............       
  
 
      

   
Alig confidence  .............








..............























Template Conservation              
  

                                           
Template Sequence  ARTTWADKDQAEAKGCHSPVVSELKETLHFKDQKQVYNEVMGWQTPVKDKFTQVKVGIQG
Template Known Secondary structure 


SS
TTTTT
TTT

S
GGG


S
Template Predicted Secondary structure 




























   720.........730.........740.........750.........760.........770.........
Predicted Secondary structure 


















































Query Sequence  IEKLFSENAIEPPPEKRPPFPLSDLIIKVLGAEKLGAEMYRLFKQTNGHLPVIGPILGAY
Query Conservation 
  
   


          
  
                  
       
         
Alig confidence 















............................................
Template Conservation                  ............................................
Template Sequence  LYSLLEVKKLAPSDKT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure  TT
SSS
............................................
Template Predicted Secondary structure 






............................................
   780.........790.........800.........810.........820. ........830........
Predicted Secondary structure 














.

Query Sequence  SIFTQNEGNPGGIEREYAEMWFWSHLQGYKGAAHAQPDISWW. WGTAQGVGNLTRIRDEA
Query Conservation            
 

     

     
   

 
  



 
. 
       
  
   
Alig confidence  ............






.......















.
















Template Conservation  ............       ....... 
               
                
Template Sequence  . . . . . . . . . . . . RVYELIE. . . . . . . KAQDTVDLIEKDGSWGMHGFKYTKQRLDAAVEYI
Template Known Secondary structure  ...................
STTTT
Template Predicted Secondary structure  ...................







   839840........
Predicted Secondary structure 


Query Sequence  EKLRRLKSGS
Query Conservation    


   
 
Alig confidence 









Template Conservation            
Template Sequence  NEAQRIMKKS
Template Known Secondary structure  T
Template Predicted Secondary structure 

Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions