Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence57.68%DateWed Nov 27 10:15:14 GMT 2024
Rank265Aligned Residues81
% Identity14%Templatec8smrM_
PDB info PDB header: membrane proteinChain: M: PDB Molecule: PDBTitle: cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa
PDB Entry: PDBe RCSB PDBj
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   613......620....... ..630....... ..640.........650......
Predicted Secondary structure 








.






...............


















Query Sequence  TCQYCHMYVGNNKWE. MNVETKGIWR. . . . . . . . . . . . . . . MGVIPPKEVEFKSGLKDFP
Query Conservation 






  
    
.


  
  
 ...............                  
Alig confidence 














.









...............


















Template Conservation   
  


  
 
    
 
                 
  
    

     
       
Template Sequence  NCSICHGSDAKGAYGFPNLTDADWRWGGEPETIKTTIMAGRHAAMPAWGEVIGEEGVKNV
Template Known Secondary structure  T
TTSB

TTS
BSSSS

SS

S






TTTS
Template Predicted Secondary structure 

































   657..660.. .......670.........680.........690...
Predicted Secondary structure 





..











Query Sequence  YGIKIP. . PMDKKLEIYSAESQEKRRKWVELCSKCHSSR
Query Conservation        ..           
    
  
  

  


  
Alig confidence 





..






























Template Conservation    

                   
       
  

   
Template Sequence  AAFVLTQMDGRKLPEGAKADIEAGKQVFATTCVACHGPE
Template Known Secondary structure 






...
SS








TTTS
TT
Template Predicted Secondary structure 

















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions