Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank104Aligned Residues265
% Identity18%Templatec6z0kA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: putative multicopper oxidase mco; PDBTitle: crystal structure of laccase from pediococcus acidilactici pp59302 (hepes ph 7.5)
PDB Entry: PDBe RCSB PDBj
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60.........70.........80.........90..
Predicted Secondary structure 


























Query Sequence  TGKDGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNK
Query Conservation           
  
     
  


    

 



   








 




 
 
 
 
Alig confidence 

































.....




















Template Conservation            
           
        

 ..... 


 
    

   
   
 
Template Sequence  RIEGNEIYYTVTAQAGETKILPGKPTHTWGYNGS. . . . . ILGPAIQFETGKTYHVTLKNE
Template Known Secondary structure  TT

SSSS.SSS.....SB

BTT

Template Predicted Secondary structure 














.....







   93......100.........110 .........120.........130.........140.........150.
Predicted Secondary structure 











.






























Query Sequence  LTVPASIHPHGVKYTTAN. VGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFER
Query Conservation 
 









  
   .


   
 

  
 






 
 

  









   
Alig confidence 

















.

.....
































.
Template Conservation 
      
 

        

.....     
 

    
        
   

 
   .
Template Sequence  LDEVTTFHWHGLNIVGPYEDG. . . . . GPHAPVYPHGERKITFTVDQPAANIWLHPHPCP.
Template Known Secondary structure  SSS
B

T



TTTTTT.....STT

B
TT


S
S


TT.
Template Predicted Secondary structure 


















.....




















.
   152.......160.........170...... ...180........
Predicted Secondary structure 












.....



..................
Query Sequence  GGEEGLSRGLWGALIVEPVGGDPNP. . . . . PDKEFVVFMHAF. . . . . . . . . . . . . . . . . .
Query Conservation     


  

 
 




       ..... 


 



 
 ..................
Alig confidence 
























.....











..................
Template Conservation          

 
 


                        
                   
Template Sequence  ETARQVWNGLAAPVIITDGHEQSLKLPRRWGVNDFPVVLQDRSYHDNQLDYKADYDVDGT
Template Known Secondary structure  TT


T




BTTT

BTTB



TT

Template Predicted Secondary structure 




































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation         

             
 
  
                   
  

     
  
Template Sequence  LGDYALVNGTVNPVVNVTKPIIRLRFLNGSNRREWRLHFADYHPFTQIGSDGGLLPEAVE
Template Known Secondary structure 

STTBSSSSS

SS

TT


TT
Template Predicted Secondary structure 


























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation       
  
 
  
 
                                   
        
Template Sequence  MDRIMLTCAERADVLVNFSDYQPGQEVILQTDDFNLIKFKIGDIKKENMLLPSPLAEIPA
Template Known Secondary structure  S

TT

TTS
TT
TT
S...





SS



..
Template Predicted Secondary structure 








































   189190.........200.........210.........220.........230.... .. ...240.
Predicted Secondary structure  ...


























.

...




Query Sequence  . . . NVNGQEYYAFNNKSGDIELMRGDSSAFPGETWKAKMGDKVRFHLIN. IT. . . EEAHT
Query Conservation  ...
  

     
    
    



   
  

 
  

 






. 
...   

Alig confidence  ...













































.

...




Template Conservation                         
                                  

Template Sequence  LSVDENTPVFKTVMSGMDDQVRLDGKLFDMQRIDTRQQVDQTQIWEVSNTNDMEGGMIHP
Template Known Secondary structure  ..

TTS


GGG
TTB


TT


TTS

S
TTT


Template Predicted Secondary structure 






































   242.......250...... ...260.........270.........280.........290..
Predicted Secondary structure 







.........















Query Sequence  FHTHGHRWLDKSCDK. . . . . . . . . LIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQE
Query Conservation 





 
 

    ......... 



 
 



 

 
 


   

 






  
Alig confidence 














.........




















...











Template Conservation   



  
 
                

          
      ... 
 
  


   
Template Sequence  FHIHGCQFQLIDRNGHAVNPNEHGWKDTIGVNPNETVRIRVKFTK. . . LGIFMYHCHILE
Template Known Secondary structure  SS

BTTB...TT
SS
BS
TT


S...
SS
Template Predicted Secondary structure 






















...







   293......300.........310.
Predicted Secondary structure 








Query Sequence  HMMNGMFGIFMVEEGKRVN
Query Conservation 
   



 
 


     
Alig confidence 


















Template Conservation 
   

     
       
Template Sequence  HEDTGMMAQIEIFDPDHPI
Template Known Secondary structure  T

TTS

Template Predicted Secondary structure 










Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions