Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank91Aligned Residues267
% Identity19%Templatec3j2qB_
PDB info PDB header: blood clottingChain: B: PDB Molecule: coagulation factor viii light chain; PDBTitle: model of membrane-bound factor viii organized in 2d crystals
PDB Entry: PDBe RCSB PDBj
Resolution15.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   35....40.........50.... .....60... ......70..
Predicted Secondary structure 






....

..................








Query Sequence  KDGAVHLEMEAKPLTIEPRP. . . . GVFFDAWGY. . . . . . . . . . . . . . . . . . CLKGDVPTV
Query Conservation         
  
     
  
....

    

 ..................



   

Alig confidence 



















....








..................



....
Template Conservation                                                         .... 
Template Sequence  QKKTRHYFIAAVERLWDYGMSSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLG. . . . L
Template Known Secondary structure 








SSSSS






SSTT







TTS
SST....T
Template Predicted Secondary structure 




























....
   73......80.........90.........100.........110.........120.........130..
Predicted Secondary structure 




































Query Sequence  PGPVIKVREGTKVKILFRNKLTVPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFE
Query Conservation 






 




 
 
 
 
 









  
   


   
 

  
 






 
Alig confidence 








































..
















Template Conservation   

      

       
        
  
          ..         

    
 
Template Sequence  LGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQG. . AEPRKNFVKPNETKTYF
Template Known Secondary structure  S...
SS
SSS
B


BS




S

S
S..S





B
TT
Template Predicted Secondary structure 

























..









   133......140 .........150.........160.........170.. ......
Predicted Secondary structure 





.........
















.....





Query Sequence  WDTAGTPG. . . . . . . . . TWFYHSYVFERGGEEGLSRGLWGALIVEPVGG. . . . . DPNPPD
Query Conservation 
 

  

.........







      


  

 
 




   .....     
Alig confidence 







.........







...




















.....





Template Conservation                      
    ...        

 
   
                
Template Sequence  WKVQHHMAPTKDEFDCKAWAYFSDV. . . DLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTV
Template Known Secondary structure 
TTS


TTS
S

S...STTTT

SS


SSSS

TT
Template Predicted Secondary structure 















...



























   179180.........190.........200.. .......210......... 220.
Predicted Secondary structure 














................









.
Query Sequence  KEFVVFMHAFNVNGQEYYAFNNKS. . . . . . . . . . . . . . . . GDIELMRGDSSAFPGET. WK
Query Conservation 

 



 
 
  

     
   ................ 
    



   
  
.
 
Alig confidence 























................
















.

Template Conservation                                                  

          
Template Sequence  QEFALFLTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLV
Template Known Secondary structure 






SSSSSTTTSS
SSS



SSSS

SSSSS


SSS

SS

S

Template Predicted Secondary structure 






























   222.......230...... ...240.........250...... ...260.........270........
Predicted Secondary structure 





..












.







Query Sequence  AKMGDKVRFHLINIT. . EEAHTFHTHGHRWLDKSCDK. LIDTIGLNPFDSYVLDFVAGEG
Query Conservation 
  

 






 
..   







 
 

    . 



 
 



 

 
 


 
Alig confidence 














..



















.




















.
Template Conservation     
                      
                                .
Template Sequence  MAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSK.
Template Known Secondary structure  SSS.B
SSSS

TT

SSSS
BT



S.
Template Predicted Secondary structure 






















.
   279280.........290.........300.........310...
Predicted Secondary structure 
















Query Sequence  VGKGNWAFHCQSQEHMMNGMFGIFMVEEGKRVNAV
Query Conservation    

 






  
   



 
 


       
Alig confidence  ..
































Template Conservation  .. 
                               
Template Sequence  . . AGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPL
Template Known Secondary structure  ..

STTTT
SSTT

Template Predicted Secondary structure  ..





















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions