Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank116Aligned Residues261
% Identity17%Templatec7qy4A_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: copper-containing nitrite reductase; PDBTitle: as isolated msox movie series dataset 5 (2 mgy) of the copper nitrite2 reductase from bradyrhizobium sp. ors 375 (two-domain)
PDB Entry: PDBe RCSB PDBj
Resolution1.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33...... 40...... ...50.... ... ..60 .........70...... ...80....
Predicted Secondary structure 



...



.

..











.



.
Query Sequence  TGKDGAV. HLEMEAK. . PLTIEPRP. GVF. FDA. WGYCLKGDVPTVPGPV. IKVREGTK.
Query Conservation         .  
  
 ..    
  
.

 .   .

 



   





.


 



.
Alig confidence 






.






..







.


.


.





.....




.







.
Template Conservation             
              
             ..... 


  
    

  
Template Sequence  KQGPKIMEEFKLVVQQEKKKMVIDEKGTTFFQAMMTFNGS. . . . . MPGPLMMVVHEGDYY
Template Known Secondary structure 




...
STT

..TTB.....SS...TT
.
Template Predicted Secondary structure 


















.....







   85....90.... .....100.........110.........120.........130.........140
Predicted Secondary structure 


....
































Query Sequence  VKILFRNKLT. . . . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPG
Query Conservation 
 
 
 
 
 ....









  
   


   
 

  
 






 
 

  

Alig confidence 









....












.......


















.





Template Conservation 
 
   
            
 

    .......        
 

       .     
Template Sequence  VEVTLVNPATNTMMMPHNIDFHSATGA. . . . . . . LGGGALTLINPGEQVVLRW. KATRTG
Template Known Secondary structure 
TT

S..
B

TTS
SG.......GGGGGG

B
TT.

S
Template Predicted Secondary structure 
















.......









.



   141........150... ......160.........170..... .. ..180.. ...
Predicted Secondary structure 









.....









........

.


.
Query Sequence  TWFYHSYVFERGG. . . . . EEGLSRGLWGALIVEPVGGDPN. . . . . . . . PP. DKEFV. VFM
Query Conservation 







     ..... 


  

 
 




      ........  .


 
.


Alig confidence 







...

.....





















........

.




.


Template Conservation     

   ...             
  
  

                   
        
Template Sequence  VFVYHCAP. . . PGGPPMIPWHVVSGMNGAVMVLPRDGLNDGHGHSSLRRYDDRIYYIIGE
Template Known Secondary structure 


....STT.TT

TT

SSS
.
.
S..
Template Predicted Secondary structure 


...































   186...190.. .......200.........210... ... ...220...
Predicted Secondary structure 


................














....


..

Query Sequence  HAFNVNG. . . . . . . . . . . . . . . . QEYYAFNNKSGDIELMRGDSS. . . . AFP. . GETWKAK
Query Conservation   
 
  
................
     
    
    



 ....  
..  

 
 
Alig confidence 






................




















....


..






Template Conservation                                           

                 
Template Sequence  QDLYVPRRDEKGNFKSYDSPGEAYSDTEEVMRKLTPTHVVFNGKKKAGALTGGKNALNAN
Template Known Secondary structure 


B.
TTS.B.

SSTT

STTS..TTTTSG.GG.
Template Predicted Secondary structure 



















































   224.....230..... ....240.........250.... .. ...260.... .....270.
Predicted Secondary structure 




.











.

........
.


.
Query Sequence  MGDKVRFHLINI. TEEAHTFHTHGHRWLDKSC. DK. . . . . . . . LIDTIGLN. PFDSYVL.
Query Conservation   

 






 .
   







 
 

  .  ........ 



 
 .



 

.
Alig confidence 



.






.


















.

........







.






.
Template Conservation   
  . 
                
          
              
   
      
Template Sequence  VGEN. NVLIVHSQANRDSRPHLIGGHGDYVWEETGKFSNAPETGLETWFIRRGGSAGAAL
Template Known Secondary structure  TT
..SSS
B
T

S.S

TTS..SB

B
.TT
Template Predicted Secondary structure 


.


























   272.......280.........290 .. .. .....300.........310...
Predicted Secondary structure 











...








Query Sequence  DFVAGEGVGKGNWAFHCQS. QE. HM. MNGMFGIFMVEEGKRVNAV
Query Conservation   
 


   

 






.  .
 .  



 
 


       
Alig confidence 





...









.

.

.


















Template Conservation        ... 
                 
                
Template Sequence  LYKFLQ. . . PGIYAYVTHNNLIEEAANLGATAHFKVEGKWNDDLM
Template Known Secondary structure  .

S...
S
.
.



S
S


TTT
Template Predicted Secondary structure 


...















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions