Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence98.40%DateWed Nov 27 10:15:14 GMT 2024
Rank142Aligned Residues127
% Identity20%Templatec8qbqA_
PDB info PDB header: electron transportChain: A: PDB Molecule: extracellular iron oxide respiratory system surface PDBTitle: crystal structure of the outer membrane decaheme cytochrome mtrc2 (a430boc-lys)
PDB Entry: PDBe RCSB PDBj
Resolution1.81 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   477..480.........490.........500.........510.........520 .........530....
Predicted Secondary structure 











..









Query Sequence  PTVDNSCGACHPKQAAEFIKGRDHGRPNHPQSWEGNVSTPWYAE. . YYRRGEGYSMVGCD
Query Conservation        
  

  
  
                      
    ..           

 
Alig confidence 




























..........




..













Template Conservation        
  

           
      ..........                   
 
Template Sequence  SVNMTACANCHTAEFEIHKGKQHAGFVMT. . . . . . . . . . EQLSHTQDANGKAIVGLDACV
Template Known Secondary structure  SB

TT

BTBTTTB



..........GGG


B
TTS.B.

SGGGG
Template Predicted Secondary structure 


















..........












   535....540. ........550. ........560
Predicted Secondary structure 





............................









...




...
Query Sequence  QCHQNMS. . . . . . . . . . . . . . . . . . . . . . . . . . . . SCDDCHSRHR. . . FSAAEARRP. . .
Query Conservation   



 
............................ 
 





 ...

  




...
Alig confidence 






............................









...








...
Template Conservation   

                  
  
           
  

                   
Template Sequence  TCHTPDGTYSFANRGALELKLHKKHVEDAYGLIGGNCASCHSDFNLESFKKKGALNTAAA
Template Known Secondary structure  GTSBTTBSSSTTS

SSTT
GGGTBS


GGGGGG



Template Predicted Secondary structure 













































   561....... .570.........580.........590.........600.......
Predicted Secondary structure  ............



.



























Query Sequence  . . . . . . . . . . . . EACSICHM. GPDHPDWESYSRSKWGVIYETTKERWNWDKNLAEVIPGE
Query Conservation  ............ 

  


.





 


  



 

       
       
  
 
Alig confidence  ............







.





























.........
Template Conservation           
    
  

                                .........
Template Sequence  ADKTGLYSTPITATCTTCHTVGSQYMVHTKETLESFGAVVDGTKDDATSAA. . . . . . . . .
Template Known Secondary structure  TTS

TTS
TTSTT

S
TT


SB
TT.........
Template Predicted Secondary structure 



































.........
   608.610.........620....
Predicted Secondary structure 










Query Sequence  DYLAPTCQYCHMYVGNN
Query Conservation 

 








  
  
Alig confidence  ..














Template Conservation  ..    
  

      
Template Sequence  . . QSETCFYCHTPTVAD
Template Known Secondary structure  ..T


B


SS
Template Predicted Secondary structure  ..











Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions