Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence97.90%DateWed Nov 27 10:15:14 GMT 2024
Rank173Aligned Residues84
% Identity21%Templatec2k3vA_
PDB info PDB header: electron transportChain: A: PDB Molecule: tetraheme cytochrome c-type; PDBTitle: solution structure of a tetrahaem cytochrome from shewanella2 frigidimarina
PDB Entry: PDBe RCSB PDBj
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   420.........430.........440.........450.........460.........470.........
Predicted Secondary structure 













































Query Sequence  EWKMSNHANPKKNPHVSAETQEIEALIGKELNNWRPGTKDGVYCSYCHGSDHEKLFMPTV
Query Conservation 

  
 

                                 
 
  

   
        
Alig confidence 









...............................


















Template Conservation        
   ...............................  
  

            
Template Sequence  ETLAEFHVEM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GGCENCHADGEPSKDGAYE
Template Known Secondary structure  .BTT...............................S
GGGS
SSS


SSS
Template Predicted Secondary structure 




...............................














   480.........490.........500.........510.........520.........530.........
Predicted Secondary structure 






















Query Sequence  DNSCGACHPKQAAEFIKGRDHGRPNHPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCHQN
Query Conservation     
  

  
  
                      
               

  



Alig confidence 















.....................................






Template Conservation     
  

        ..................................... 
     
Template Sequence  FEQCQSCHGSLAEMDD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NHKPHDG
Template Known Secondary structure  TSSSS

GGGS
T.....................................TSS
Template Predicted Secondary structure 







.....................................






   540.........550.........560.........570....
Predicted Secondary structure 


























Query Sequence  MSSCDDCHSRHRFSAAEARRPEACSICHMGPDHPD
Query Conservation   
 
 





 

  




 

  








Alig confidence 














...
















Template Conservation     
  

  
    ...     
  

       
Template Sequence  LLMCADCHAPHEAKV. . . GEKPTCDTCHDDGRTAK
Template Known Secondary structure  SS
S
TTT
BS...S



GGGT

S




Template Predicted Secondary structure 










...











Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions