Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence95.94%DateWed Nov 27 10:15:14 GMT 2024
Rank217Aligned Residues81
% Identity16%Templatec4txvB_
PDB info PDB header: protein bindingChain: B: PDB Molecule: cytochrome c oxidase subunit 2; PDBTitle: crystal structure of the mixed disulfide intermediate between2 thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase3 coxbpd (c233s)
PDB Entry: PDBe RCSB PDBj
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   217..220.........230.........240.........250.........260.........270......
Predicted Secondary structure 


























Query Sequence  GETWKAKMGDKVRFHLINITEEAHTFHTHGHRWLDKSCDKLIDTIGLNPFDSYVLDFVAG
Query Conservation    

 
  

 






 
   







 
 

     



 
 



 

 
 

Alig confidence 



















.






..........





















Template Conservation        
 
  
     
 
.  
   
..........          

          
Template Sequence  DNEMVVPVNKVIRVQVTGAD. VIHAFAL. . . . . . . . . . PAFGVKIDAIPGRLNETWFKAA
Template Known Secondary structure  SS
TTSSS.S
..........GGGT
TT



Template Predicted Secondary structure 







.



..........









   277..280......... 290.........300.........310.
Predicted Secondary structure 








.









Query Sequence  EGVGKGNWAFHCQ. SQEHMMNGMFGIFMVEEGKRVN
Query Conservation 
   

 





.
  
   



 
 


     
Alig confidence 
...








.





















Template Conservation   ... 
     
   

  
  
     
       
Template Sequence  K. . . TGMFYGQCSELSGKDHAFMPIAIRVVEDKEFA
Template Known Secondary structure  S...




SS


TT





Template Predicted Secondary structure 
...








Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions