Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank7Aligned Residues400
% Identity30%Templatec4n4jA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: hydroxylamine oxidoreductase; PDBTitle: kuenenia stuttgartiensis hydroxylamine oxidoreductase
PDB Entry: PDBe RCSB PDBj
Resolution1.80 Å
Model Dimensions (Å)X:61.833 Y:66.272 Z:77.099

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   360.........370.........380.........390.........400.........410.........
Predicted Secondary structure 

































Query Sequence  LEKGDGIWGDYYSPIPLYTYFNPSRHYVPPESDAYTNLLVKYRPDQCVECHEETTPGIVA
Query Conservation       
             
  
   
                   

 

   




 
Alig confidence 































.....






















Template Conservation                                  .....         
  

         
Template Sequence  YVDGRGPYKSFLKMLPSIRWYDPEHYWTNGSQ. . . . . TEGVFKNEECVLCHTVQTPTIVN
Template Known Secondary structure 


STTTTT

GGGGGTS





.....


B

S
Template Predicted Secondary structure 























.....



















   420.........430.........440.........450.........460.........470.........
Predicted Secondary structure 













































Query Sequence  EWKMSNHANPKKNPHVSAETQEIEALIGKELNNWRPGTKDGVYCSYCHGSDHEKLFMPTV
Query Conservation 

  
 

                                 
 
  

   
        
Alig confidence 







.............






































Template Conservation      
 
 .............                      
  

            
Template Sequence  DWKQSSHG. . . . . . . . . . . . . SKDIRRGIGIKKDGKPVEDLVGCADCHGNNHQKLEMPTY
Template Known Secondary structure  TSTTT.............
GGG





TT

S



SBTTS




Template Predicted Secondary structure 






.............



































   480.........490.........500.........510.........520.........530.........
Predicted Secondary structure 






















Query Sequence  DNSCGACHPKQAAEFIKGRDHGRPNHPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCHQN
Query Conservation     
  

  
  
                      
               

  



Alig confidence  .

















......


































Template Conservation  .  
  

           ......                            
  

  
Template Sequence  . KLCNDCHPKETAEHRAGG. . . . . . LGSHTHAYTVNVLEFSWHVGKPAEEVTGCAHCHAI
Template Known Secondary structure  .TT
T


......TTSGGGTTTTTTTT
TS
GGGS
Template Predicted Secondary structure  .





......




























   540.........550.........560.........570.........580.........590........
Predicted Secondary structure  .







































Query Sequence  . MSSCDDCHSRHRFSAAEARRPEACSICHMGPDHPDWESYSRSKWGVIYETTKERWNWDK
Query Conservation  . 
 
 





 

  




 

  








 


  



 

       
   
Alig confidence  .


























































Template Conservation      
  

               
  

             
 

              
Template Sequence  AENRCSGCHTRHKFDPAEARKPTACRVCHMGIDHDEWAMYNTSIHGALYEAESARMDWGK
Template Known Secondary structure 
S
SSS
TTT

TSGGGTTTTS
STT

TSTTTS
TTS
Template Predicted Secondary structure 
















































   599600.........610.........620.........630.........640.........650........
Predicted Secondary structure 


















































Query Sequence  NLAEVIPGEDYLAPTCQYCHMYVGNNKWEMNVETKGIWRMGVIPPKEVEFKSGLKDFPYG
Query Conservation      
  
 

 








  
    



  
  
                   
  
Alig confidence  ....






















...........................





Template Conservation  ....           
  

     
 ...........................      
Template Sequence  . . . . KLKKGNYRVPTCAYCHMQNGDHN. . . . . . . . . . . . . . . . . . . . . . . . . . . PQRFGT
Template Known Secondary structure  ....
S
TTS
SS

SGGG
S
...........................GGGGSS
Template Predicted Secondary structure  ....






















...........................





   659660.........670.........680.........690.........700.........710........
Predicted Secondary structure 















Query Sequence  IKIPPMDKKLEIYSAESQEKRRKWVELCSKCHSSRFAGMWLDSLDQYMFESWRRIDEAQL
Query Conservation                 
    
  
  

  


  

       
  
 
      

  
Alig confidence 



























































Template Conservation                             
  

                            
Template Sequence  IYSDMGMFQVDRGAPKHKAKRDSWIKLCQDCHSPRFAADKLKEMDAGVNLSFTKWREAAA
Template Known Secondary structure 


TTTTS


TTSGGGTTSS
Template Predicted Secondary structure 


















   719720.........730.........740.........750.........760.........770........
Predicted Secondary structure 

















































Query Sequence  IIEKLFSENAIEPPPEKRPPFPLSDLIIKVLGAEKLGAEMYRLFKQTNGHLPVIGPILGA
Query Conservation   
  
   


          
  
                  
       
        
Alig confidence 



















....

















..................
Template Conservation          
           ....                  ..................
Template Sequence  VIVGCYLDGVVDPMPEGSAP. . . . DWYGHYTFSLLPGGDPRF. . . . . . . . . . . . . . . . . .
Template Known Secondary structure  TT

SS
GGGS......
TTS



TTSTTS


S..................
Template Predicted Secondary structure 












....













..................
   779780.........790.........800.........810.........820.. .......830......
Predicted Secondary structure 
















..
Query Sequence  YSIFTQNEGNPGGIEREYAEMWFWSHLQGYKGAAHAQPDISWWW. . GTAQGVGNLTRIRD
Query Conservation             
 

     

     
   

 
  



 
 ..
       
  
  
Alig confidence  ........



































..













Template Conservation  ........                                                    
Template Sequence  . . . . . . . . YATSNLERLGLEMICYLTGNVYKAYAHMSMYNQTYGNGSAFEQDRKLVEIKT
Template Known Secondary structure  ........SSS







TT
TSTTS
Template Predicted Secondary structure  ........












   837..840.....
Predicted Secondary structure 
Query Sequence  EAEKLRRLK
Query Conservation   
  


  
Alig confidence 








Template Conservation           
Template Sequence  EAAKLRRFA
Template Known Secondary structure 
Template Predicted Secondary structure 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in JSmol

Send structure to FirstGlance for more viewing options

Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions