Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank107Aligned Residues262
% Identity18%Templatec1ndsA_
PDB info PDB header: Blank PDB headerPDB COMPND:
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.... .....60.........70.........80.........90.
Predicted Secondary structure 







.

















Query Sequence  TGKDGAVHLEMEAKPLTIEPRP. GVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRN
Query Conservation           
  
     
  
.

    

 



   








 




 
 
 
Alig confidence 





















.











.....



















Template Conservation                                     ..... 


 
    

       
Template Sequence  AGAPKVVQFRMSIEEKKMVADDDGTTAQAMTFNGS. . . . . VPGPTLVVHEGDYIELTLVN
Template Predicted Secondary structure 












.....






   92.. .....100.........110.........120.........130.........140.........
Predicted Secondary structure 


..






































Query Sequence  KLT. . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVF
Query Conservation   
 ..









  
   


   
 

  
 






 
 

  









 
Alig confidence 


..









...





..




..












.












Template Conservation               
 ...      ..     ..
  
         .   
         
Template Sequence  PATNSMPHNVDFHAA. . . TGALGG. . AGLTQ. . VVPGQEAVLRFKA. DRSGTFVYHCAPA
Template Predicted Secondary structure 











...





..

..




.






   150.........160.........170. ........180.........190.......
Predicted Secondary structure 









......
















......
Query Sequence  ERGGEEGLSRGLWGALIVEPVG. . . . . . GDPNPPDKEFVVFMHAFNVNGQEYYA. . . . . .
Query Conservation       


  

 
 




  ......      


 



 
 
  

    ......
Alig confidence 
.



















......

























......
Template Conservation   .        
  
   
                                          
Template Sequence  G. MVPWHVVSGMNGALMVLPRDGLRDAAGAALAYDRVYTIGESDLYVPKAADGNYSDYPA
Template Predicted Secondary structure 
.







































   198.200.........210....... ..220.........230..... ....240....
Predicted Secondary structure  .........













...





.





Query Sequence  . . . . . . . . . FNNKSGDIELMRGDSSAFPG. . . ETWKAKMGDKVRFHLINI. TEEAHTFHT
Query Conservation  ......... 
    
    



   
 ... 

 
  

 






 .
   




Alig confidence  .........



















...










..




.








Template Conservation                        

               
   ..               
Template Sequence  LASAYADTVAVMRTLTPSHAVFNGAVGALTGANALTAAVGESV. . LIIHSQANRDSRPHL
Template Predicted Secondary structure 





























..







   245....250...... ...260.........270.........280.........290.... .
Predicted Secondary structure 







........















.
Query Sequence  HGHRWLDKSCDK. . . . . . . . LIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHM. M
Query Conservation 


 
 

    ........ 



 
 



 

 
 


   

 






  
 . 
Alig confidence 











........




















...













.
Template Conservation                            
  
           ... 
              
Template Sequence  IGGHGDWVWTTGKFANPPQLNMETWFIPGGSAAAALYTFKQ. . . PGTYAYLSHNLIEAME
Template Predicted Secondary structure 





















...







   296...300.........310...
Predicted Secondary structure 








Query Sequence  NGMFGIFMVEEGKRVNAV
Query Conservation   



 
 


       
Alig confidence 

















Template Conservation   
                
Template Sequence  LGAAAQASVEGQWDDDLM
Template Predicted Secondary structure 









Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions