Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence98.51%DateWed Nov 27 10:15:14 GMT 2024
Rank129Aligned Residues249
% Identity14%Templatec2e84A_
PDB info PDB header: electron transportChain: A: PDB Molecule: high-molecular-weight cytochrome c; PDBTitle: crystal structure of high-molecular weight cytochrome c from2 desulfovibrio vulgaris (miyazaki f) in the presence of zinc ion
PDB Entry: PDBe RCSB PDBj
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   372.......380.........390.........400.. .......410..... ...
Predicted Secondary structure 





















.........




....
Query Sequence  SPIPLYTYFNPSRHYVPPESDAYTNLLVKYR. . . . . . . . . PDQCVECHEETTP. . . . GIV
Query Conservation         
  
   
                .........   

 

   

....


Alig confidence 






























.........












....


Template Conservation                                             
  

            
Template Sequence  EQRADLVEIGVMAKFGNLELPKVTFPHDRHSEAVAKVAAPGKECATCHKNDDKGKMSLKF
Template Known Secondary structure 
S

GGGGGS

SS..

STTTTTTT

B
SS

B
SSS
Template Predicted Secondary structure 









































   419420.........430.........440.........450.........460.........470........
Predicted Secondary structure 












































Query Sequence  AEWKMSNHANPKKNPHVSAETQEIEALIGKELNNWRPGTKDGVYCSYCHGSDHEKLFMPT
Query Conservation   

  
 

                                 
 
  

   
       
Alig confidence 










..........................






















Template Conservation             ..........................       
  

           
Template Sequence  MRLEDTTAADL. . . . . . . . . . . . . . . . . . . . . . . . . . KNIYHANCIGCHTEQAKAGKKTG
Template Known Secondary structure  S
SS


..........................TT



Template Predicted Secondary structure 






..........................




















   479 480.........490.........500.........510.........520.........530.......
Predicted Secondary structure 
.




















Query Sequence  V. DNSCGACHPKQAAEFIKGRDHGRPNHPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCH
Query Conservation   .   
  

  
  
                      
               

  

Alig confidence 
.











..




......
































Template Conservation       
  

    ..     ......                            
  

Template Sequence  PQDGECRSCHNPKP. . MASSW. . . . . . KQIGLDKSLHFRHVAAKAIAPVNDPQKNCGACH
Template Known Secondary structure 

TT
S
SS
..


......





S
TTS


SSSS

GGGT
Template Predicted Secondary structure 








..




......






















   538 .540.........550.. .......560.........570.........580
Predicted Secondary structure 
..............













...













Query Sequence  Q. . . . . . . . . . . . . . NMSSCDDCHSRHRF. . . SAAEARRPEACSICHMGPDHPDWESYSR
Query Conservation 
..............
 
 
 





 
...
  




 

  








 


  
Alig confidence 
..............













...





















......
Template Conservation                     
  

                  
  

       ......
Template Sequence  HVYDEAAKKLSWVKNKEDSCRACHGDARVEKKPSLREAAHTQCITCHRSVAAAP. . . . . .
Template Known Secondary structure 
TTTT

TT





SS

SSS

ST......
Template Predicted Secondary structure 












































......
   581........590.........600.........610.........620.........630.........640
Predicted Secondary structure 













































Query Sequence  SKWGVIYETTKERWNWDKNLAEVIPGEDYLAPTCQYCHMYVGNNKWEMNVETKGIWRMGV
Query Conservation 



 

       
       
  
 

 








  
    



  
  
    
Alig confidence  ........................



































Template Conservation  ........................         
  

                      
Template Sequence  . . . . . . . . . . . . . . . . . . . . . . . . AKADSGPVSCAGCHDPAMQAKFKVVRDVPRLERGQP
Template Known Secondary structure  ........................T






S
TTS


TT




SS

Template Predicted Secondary structure  ........................
































   641........650.........660.........670.........680.........690..
Predicted Secondary structure 

































Query Sequence  IPPKEVEFKSGLKDFPYGIKIPPMDKKLEIYSAESQEKRRKWVELCSKCHSS
Query Conservation                 
                 
    
  
  

  


 
Alig confidence 



























........















Template Conservation                              ........         
  

  
Template Sequence  DAAMVLPVVGPGAKKGMKGAMKPVAFNH. . . . . . . . KVHEAASNTCRACHHV
Template Known Secondary structure  S

...SS

SS


SS

........T
S
STTTS
S
Template Predicted Secondary structure 























........


Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions