Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank110Aligned Residues256
% Identity18%Templatec5anhA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: laccase; PDBTitle: crystal structure of laccase from basidiomycete pm1 (cect 2971)
PDB Entry: PDBe RCSB PDBj
Resolution2.49 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.........70.........80.........90....
Predicted Secondary structure 


























.
Query Sequence  DGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKLT.
Query Conservation        
  
     
  


    

 



   








 




 
 
 
 
 .
Alig confidence 

















.











.....






















.
Template Conservation                    .            ..... 


 
    
    
   
    
Template Sequence  SIGPVADLTISNGAVSPD. GFSRQAILVNDV. . . . . FPSPLITGNKGDRFQLNVIDNMTN
Template Known Secondary structure 
B
S
TT.S

TTB.....SS...TT




Template Predicted Secondary structure 






.



.....











   95....100.........110.........120.........130.........140.........150
Predicted Secondary structure  ....







































Query Sequence  . . . . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFE
Query Conservation  ....









  
   


   
 

  
 






 
 

  









  
Alig confidence  ....





















































..
Template Conservation           
 

         

        
 

    
        
   

 
 ..
Template Sequence  HTMLKSTSIHWHGFFQHGTNWADGPAFVNQCPISTGHAFLYDFQVPDQAGTFWYHSHL. .
Template Known Secondary structure  STT
S
B
T


TT
GGGS

BTTTB..B.TT

TT


S..
Template Predicted Secondary structure 


































..
   151........160.........170....... ..180.........190.........200......
Predicted Secondary structure 














....

















Query Sequence  RGGEEGLSRGLWGALIVEPVGGDPNPP. . . . DKEFVVFMHAFNVNGQEYYAFNNKSGDIE
Query Conservation      


  

 
 




        ....


 



 
 
  

     
    
  
Alig confidence  ...























....
















...








Template Conservation  ...      
  
  

                               ...         
Template Sequence  . . . STQYCDGLRGPIVVYDPQDPHKSLYDVDDDSTVITLADWYHLAAK. . . VGPAVPTAD
Template Known Secondary structure  ...TTGGGGT

TT
TTGGG
SB
SGGG
SS
TT...TS
SS


S
Template Predicted Secondary structure  ...





















...








   207..210........ .220.........230.....
Predicted Secondary structure 







.......




........................
Query Sequence  LMRGDSSAFPGE. . . . . . . TWKAKMGDKVRFHLINI. . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation    



   
  .......

 
  

 






 ........................
Alig confidence 











.......
















........................
Template Conservation      

                   
     
  
                     

  
Template Sequence  ATLINGLGRSIDTLNADLAVITVTKGKRYRFRLVSLSCDPNHTFSIDGHSLTVIEADSVN
Template Known Secondary structure  TTB


SS
TTS



TT


SS

TT

TT
Template Predicted Secondary structure 




























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation    
          
 
    
                                       
Template Sequence  LKPQTVDSIQIFAAQRYSFVLNADQDVDNYWIRALPNSGTRNFDGGVNSAILRYDGAAPV
Template Known Secondary structure  SB
TT


S
SSSSSS
S
GGGTTTTS
SS
Template Predicted Secondary structure 






























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                     

       
Template Sequence  EPTTTQTPSTQPLVESALTTLEGTAAPGNPTPGGVDLALNMAFGFAGGRFTINGASFTPP
Template Known Secondary structure 


...


SSB

GGG

BTT
...SS
SSTT
SS

TTTTB




Template Predicted Secondary structure 











































   236...240.........250..
Predicted Secondary structure  ...........................................









Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TEEAHTFHTHGHRWLDK
Query Conservation  ...........................................
   







 
 

Alig confidence  ...........................................
















Template Conservation                                                 

 



  
 
 
Template Sequence  TVPVLLQILSGAQSAQDLLPSGSVYSLPANADIEISLPATSAAPGFPHPFHLHGHTFAVV
Template Known Secondary structure  SS
T

SGGGSSSTTS
TT




TTSSS
S
TT

Template Predicted Secondary structure 


































   253 ......260.... .....270.........280.........290.........300.
Predicted Secondary structure 
..........



.

















Query Sequence  S. . . . . . . . . . CDKLIDTIGLN. PFDSYVLDFVAGEGVGKGNWAFHCQSQEHMMNGMFGI
Query Conservation   ..........    



 
 .



 

 
 


   

 






  
   



 
Alig confidence 
..........










.












...




















Template Conservation                  

           
      ... 
    


   
   

   
Template Sequence  RSAGSSTYNYANPVYRDVVSTGSPGDNVTIRFRTDN. . . PGPWFLHCHIDFHLEAGFAVV
Template Known Secondary structure 
TT





SS..S

STT





...
SSTTT
Template Predicted Secondary structure 























...




   302......
Predicted Secondary structure 


Query Sequence  FMVEEGK
Query Conservation 
 


  
Alig confidence 






Template Conservation         
Template Sequence  MAEDIPE
Template Known Secondary structure  TGGG
Template Predicted Secondary structure 

Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions