Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence98.67%DateWed Nov 27 10:15:14 GMT 2024
Rank158Aligned Residues93
% Identity22%Templatec1ft6A_
PDB info PDB header: electron transportChain: A: PDB Molecule: cytochrome c554; PDBTitle: reduced state of cytochrome c554 from nitrosomonas europaea
PDB Entry: PDBe RCSB PDBj
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   478.480.........490.........500.........510.........520....... ..530..
Predicted Secondary structure 
















.....



Query Sequence  TVDNSCGACHPKQAAEFIKGRDHGRPNHPQSWEGNVSTPWYAEYYRRGEG. . . . . YSMVG
Query Conservation       
  

  
  
                      
           .....    
Alig confidence 




















......






















.....




Template Conservation       
  

      
  
 ......
                                
Template Sequence  EGRKKCSSCHKAQAQSWKDTA. . . . . . HAKAMESLKPNVKKEAKQKAKLDPAKDYTQDKD
Template Known Secondary structure 

S
TTSG......GGGTTGGGSTTSSTT

TT


TT
TT
Template Predicted Secondary structure 






......















   533.... ..540.........550......
Predicted Secondary structure 

..................















..................
Query Sequence  CDQCH. . . . . . . . . . . . . . . . . . QNMSSCDDCHSRHRFSAAE. . . . . . . . . . . . . . . . . .
Query Conservation 
  

..................

 
 
 





 

  
..................
Alig confidence 




..................


















..................
Template Conservation 
  

                    

 
  

                           
Template Sequence  CVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRGDHRKSGQAFEKSGKKTPRK
Template Known Secondary structure  TGGGSBS
TTSTT


SSS

GGGBSS



TT


Template Predicted Secondary structure 














































   557..560.........570......
Predicted Secondary structure  ........












Query Sequence  . . . . . . . . ARRPEACSICHMGPDHPDWE
Query Conservation  ........



 

  








 
Alig confidence  ........



















Template Conservation                
  

         
Template Sequence  DLAKKGQDFHFEERCSACHLNYEGSPWK
Template Known Secondary structure  TT

S

T
STT
SST
Template Predicted Secondary structure 


















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions