Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence60.79%DateWed Nov 27 10:15:14 GMT 2024
Rank263Aligned Residues78
% Identity14%Templatec6xkxI_
PDB info PDB header: translocase/oxidoreductaseChain: I: PDB Molecule: PDBTitle: r. capsulatus ciii2civ tripartite super-complex, conformation a (sc-2 1a)
PDB Entry: PDBe RCSB PDBj
Resolution6.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   614.....620.........630.........640.........650........ .660.....
Predicted Secondary structure 



































..






......
Query Sequence  CQYCHMYVGNNKWEMNVETKGIWRMGVIPPKEVEFKSGLKDFPYG. . IKIPPMD. . . . . .
Query Conservation 





  
    



  
  
                   
  ..       ......
Alig confidence 












































..






......
Template Conservation 
  

   
 
    
 
                    
 

       
   
   
  
Template Sequence  CAQCHGAGAGGNTGFPSLLDGDWLHGGSIETIYTNIKHGIMPAHLTDELLEPAQIDDVVQ
Template Known Secondary structure  T
SSS

BTTB

SSSS

SS
SS




TTTSTTS
Template Predicted Secondary structure 





































   666...670.........680.........690.
Predicted Secondary structure  .....








Query Sequence  . . . . . KKLEIYSAESQEKRRKWVELCSKCHS
Query Conservation  .....        
    
  
  

  


Alig confidence  .....

























Template Conservation 
                
       
  


Template Sequence  YVLKISGQPADEARATAGQQVFADNCVSCHG
Template Known Secondary structure  S



STT
Template Predicted Secondary structure 










Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions