Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence49.03%DateWed Nov 27 10:15:14 GMT 2024
Rank277Aligned Residues34
% Identity24%Templatec6ef8D_
PDB info PDB header: electron transportChain: D: PDB Molecule: c-type cytochrome omcs; PDBTitle: cryo-em of the omcs nanowires from geobacter sulfurreducens
PDB Entry: PDBe RCSB PDBj
Resolution3.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   538.540.........550... ......560.........570.
Predicted Secondary structure 















..................









Query Sequence  QNMSSCDDCHSRHRFS. . . . . . . . . . . . . . . . . . AAEARRPEACSICHMGPD
Query Conservation 

 
 
 





 

..................  




 

  





Alig confidence 















..................

















Template Conservation       
  

  
 
                  

        

 

    
Template Sequence  GGVAECEGCHTMHNSLGGAVMNSATAQFTTGPMLLQGATQSSSCLNCHQHAG
Template Known Secondary structure  TS


B
SSS
BTTB
S
TTS
TT


GGGBSSSSTTTTTTTTSS
SS
Template Predicted Secondary structure 





































Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions