Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank58Aligned Residues256
% Identity22%Templatec5ocfA_
PDB info PDB header: electron transportChain: A: PDB Molecule: nitrite reductase, copper-containing; PDBTitle: crystal structure of nitric oxide bound to three-domain heme-cu2 nitrite reductase from ralstonia pickettii
PDB Entry: PDBe RCSB PDBj
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60.........70.........80.........90..
Predicted Secondary structure 


























Query Sequence  TGKDGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNK
Query Conservation           
  
     
  


    

 



   








 




 
 
 
 
Alig confidence 

































.....




















Template Conservation                                    .....   
      
        
 
Template Sequence  RTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGT. . . . . VPGSFIRVRQGDTVEFHLKNH
Template Known Secondary structure 
SS

TTTTB.....SS

BTT

Template Predicted Secondary structure 











.....








   93. .....100.........110.........120.........130.........140.........150
Predicted Secondary structure 

..







































Query Sequence  LT. . VPASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFE
Query Conservation 
 ..









  
   


   
 

  
 






 
 

  









  
Alig confidence 

..














.......
















.














.
Template Conservation              
      .......                 .     
         .
Template Sequence  PSSKMPHNIDLHGVTGPGG. . . . . . . GAASSFTAPGHESQFTF. KALNEGIYVYHCATA.
Template Known Secondary structure  TT
SS
B

TT

SGGG.......GTTT

B
TT
.

S



S.
Template Predicted Secondary structure 












.......








.







.
   151........160.........170.........180.........190... ......200...
Predicted Secondary structure 





















.......









Query Sequence  RGGEEGLSRGLWGALIVEPVGGDPNPPDKEFVVFMHAFNVNGQ. . . . . . . EYYAFNNKSG
Query Conservation      


  

 
 




        


 



 
 
  

.......     
    
Alig confidence  .



















.




















.......









Template Conservation  .        
  
   
    .                                      
Template Sequence  . PVGMHIANGMYGLILVEPPE. GLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDE
Template Known Secondary structure  .STT

TT.
...
S
BSS.TT

..B
TT
Template Predicted Secondary structure  .








.






















   204.....210...... ...220.........230...... ...240.........250......
Predicted Secondary structure 






...







.












...
Query Sequence  DIELMRGDSSAFP. . . GETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLDKSCDK. . .
Query Conservation 
    



   
...  

 
  

 






 
.   







 
 

    ...
Alig confidence 












...



















.



















...
Template Conservation         
                
        
                          
Template Sequence  RPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTN
Template Known Secondary structure 

STTSTTTTSGGG
TT
SS

T

TT
S
Template Predicted Secondary structure 





































   257..260.........270.........280.........290.... .....300.......
Predicted Secondary structure  ...















.




Query Sequence  . . . LIDTIGLNPFDSYVLDFVAGEGVGKGNWAFHCQSQEHM. MNGMFGIFMVEEG
Query Conservation  ... 



 
 



 

 
 


   

 






  
 .  



 
 


 
Alig confidence  ...




















...













.












Template Conservation                          ... 
                          
Template Sequence  VQKNVQTTLIPAGGAAVVKFTARV. . . PGSYVLVDHSIFRAFNKGAMAILKIDGA
Template Known Secondary structure 
S
TT


S...
SSS

S
Template Predicted Secondary structure 












...








Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions