Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank87Aligned Residues257
% Identity20%Templatec6im8A_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: blue copper oxidase cueo,pm2 peptide,blue copper oxidase PDBTitle: cueo-pm2 multicopper oxidase
PDB Entry: PDBe RCSB PDBj
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.........70.........80.........90.....
Predicted Secondary structure 



























Query Sequence  DGAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKLTV
Query Conservation        
  
     
  


    

 



   








 




 
 
 
 
 
Alig confidence 






















.






.....























Template Conservation                         .       ..... 


      
        
 
  
Template Sequence  DARNRIQLTIGAGQSTFGGKTAT. TWGYNGN. . . . . LLGPAVKLQRGKAVTVDIYNQLTE
Template Known Secondary structure 
TTSTT.SSS.....SB

TT

SSS
Template Predicted Secondary structure 







.


.....











   96...100.........110.........120.........130.........140.........150.....
Predicted Secondary structure 









































Query Sequence  PASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFERGGEE
Query Conservation 








  
   


   
 

  
 






 
 

  









      
Alig confidence 
















.....
































.



Template Conservation      
 

        
.....     
  
    
        
    
 
   .    
Template Sequence  ETTLHWHGLEVPGEVDG. . . . . GPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHG. KTGR
Template Known Secondary structure 
B

T



GGGS
.....
TT

B
TT


S
S


TT.T
Template Predicted Secondary structure 










.....





















.
   156...160.........170....... ..180.........190...
Predicted Secondary structure 











.....






.................
Query Sequence  GLSRGLWGALIVEPVGGDPNPP. . . . . DKEFVVFMHAFNVNGQ. . . . . . . . . . . . . . . . .
Query Conservation 

  

 
 




        .....


 



 
 
  

.................
Alig confidence 





















.....















.................
Template Conservation      

 
  

                                                
Template Sequence  QVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWF
Template Known Secondary structure  T


TTGGGG




BTTT
B
TTSSB







Template Predicted Secondary structure 











































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation        

         
   
 
 

                  

  

         
Template Sequence  GDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKV
Template Known Secondary structure 
STTBSS
S

SS

TT


TT
Template Predicted Secondary structure 































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation      
  
 
    
                                             
Template Sequence  SELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGAL
Template Known Secondary structure  S

TT

SS




SSTTTTSTTTTS

S





Template Predicted Secondary structure 




































   194.....200.........210..
Predicted Secondary structure  .........................................












Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . EYYAFNNKSGDIELMRGDS
Query Conservation  .........................................     
    
    



Alig confidence  .........................................


















Template Conservation                                                            
 
Template Sequence  PDTLSSLPALPSLEGLTVRKLQLSMDPILDMMGMQMLMEKYGDQAMAGMFDFHHANKING
Template Known Secondary structure 
S




.....
TT.
GGGGGTTSSSGGG
TT
Template Predicted Secondary structure 

















































   213... ...220.........230...... ...240.........250...... ...260
Predicted Secondary structure 



..







.












.........
Query Sequence  SAFP. . GETWKAKMGDKVRFHLINIT. EEAHTFHTHGHRWLDKSCDK. . . . . . . . . LIDT
Query Conservation     
..  

 
  

 






 
.   







 
 

    ......... 


Alig confidence 



..



















.



















.........



Template Conservation                
        
      

 



  
 
                

Template Sequence  QAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDT
Template Known Secondary structure  B


TT

SBTS

TT

S
TT

BTTB...GGGSSS
Template Predicted Secondary structure 










































   261.... ....270.........280.. .......290.........300.......
Predicted Secondary structure 

.









..








Query Sequence  IGLNP. FDSYVLDFVAGEGVGKG. . NWAFHCQSQEHMMNGMFGIFMVEEG
Query Conservation 
 
 
.


 

 
 


   

.. 






  
   



 
 


 
Alig confidence 




.











...

..
























Template Conservation                    ...   
    


   
   

     
   
Template Sequence  VKVEGNVSEVLVKFNHDA. . . PKEHAYMAHCHLLEHEDTGMMLGFTVKDP
Template Known Secondary structure  SSS
B
S
B...
GGG
SSTT


Template Predicted Secondary structure 





...


















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions