Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence90.47%DateWed Nov 27 10:15:14 GMT 2024
Rank194Aligned Residues80
% Identity21%Templatec1pmyA_
PDB info PDB header: electron transfer(cuproprotein)Chain: A: PDB Molecule: pseudoazurin; PDBTitle: refined crystal structure of pseudoazurin from methylobacterium2 extorquens am1 at 1.5 angstroms resolution
PDB Entry: PDBe RCSB PDBj
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   215....220.........230.........240.........250.........260.........270....
Predicted Secondary structure 


























Query Sequence  FPGETWKAKMGDKVRFHLINITEEAHTFHTHGHRWLDKSCDKLIDTIGLNPFDSYVLDFV
Query Conservation   
  

 
  

 






 
   







 
 

     



 
 



 

 
 
Alig confidence 





















........





























Template Conservation    
       
  
        ........                              
Template Sequence  FDPALVRLKPGDSIKFLPTDKG. . . . . . . . HNVETIKGMAPDGADYVKTTVGQEAVVKFD
Template Known Secondary structure  SS
TT

SSSS........



TTSS
TT...
B..TTS


Template Predicted Secondary structure 









........




















   275....280.........290.........300...... ...
Predicted Secondary structure 















.


Query Sequence  AGEGVGKGNWAFHCQSQEHMMNGMFGIFMVEE. GKR
Query Conservation 


   

 






  
   



 
 


.   
Alig confidence 
.....









..













.


Template Conservation   ..... 
        ..       
   
      
Template Sequence  K. . . . . EGVYGFKCAP. . HYMMGMVALVVVGDKRDN
Template Known Secondary structure  S.....

ST..TTTTT
SS

TT
Template Predicted Secondary structure 
.....



..











Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions