Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank32Aligned Residues263
% Identity24%Templatec3g5wA_
PDB info PDB header: metal binding proteinChain: A: PDB Molecule: multicopper oxidase type 1; PDBTitle: crystal structure of blue copper oxidase from nitrosomonas europaea
PDB Entry: PDBe RCSB PDBj
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70.........80.........90......
Predicted Secondary structure 



























Query Sequence  GAVHLEMEAKPLTIEPRPGVFFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFRNKLTVP
Query Conservation       
  
     
  


    

 



   








 




 
 
 
 
 

Alig confidence 





























.....
























Template Conservation                                ..... 


 
    
        
     
Template Sequence  EKREFDLSIEDTRIVLVGKRDFHTFAFNGQ. . . . . VPAPLIHVMEGDDVTVNVTNMTTLP
Template Known Secondary structure 
TTTTB.....SS..TT

SSS
Template Predicted Secondary structure 








.....












   97..100.........110.........120.........130.........140.........150......
Predicted Secondary structure 








































Query Sequence  ASIHPHGVKYTTANVGVNIAGNPASIVAPGDSRIFEWDTAGTPGTWFYHSYVFERGGEEG
Query Conservation 







  
   


   
 

  
 






 
 

  









      

Alig confidence 




































.













...




Template Conservation        
                      
       .     
        ...     
Template Sequence  HTIHWHGMLQRGTWQSDGVPHATQHAIEPGDTFTYKF. KAEPAGTMWYHCHV. . . NVNEH
Template Known Secondary structure  B

T


TT
GGGS

BTTTB

B
TT
.

S


S...S
Template Predicted Secondary structure 





























.





...


   157.. 160.........170..... ....180.........190.........200 .........210..
Predicted Secondary structure 
.








..















.





Query Sequence  LSR. GLWGALIVEPVGGDPN. . PPDKEFVVFMHAFNVNGQEYYAFNN. KSGDIELMRGDS
Query Conservation 
  .

 
 




      ..  


 



 
 
  

     
 .   
    



Alig confidence 


.















..
























.











Template Conservation      

 
   
                                             


Template Sequence  VTMRGMWGPLIVEPKNPLPIEKTVTKDYILMLSDWVSSWANKPGEGGIPGDVFDYYTINA
Template Known Secondary structure  S


SS

T


GGGTT
TT



TT



TT
Template Predicted Secondary structure 





































   213... ...220.........230.........240.........250... ......260....
Predicted Secondary structure 



.

















.......



Query Sequence  SAFP. GETWKAKMGDKVRFHLINITEEAHTFHTHGHRWLDKS. . . . . . . CDKLIDTIGLN
Query Conservation     
.  

 
  

 






 
   







 
 

 .......    



 
 
Alig confidence 



.




































.......










Template Conservation               
        
           
        
              
 
Template Sequence  KSFPETQPIRVKKGDVIRLRLIGAGDHVHAIHTHGHISQIAFKDGFPLDKPIKGDTVLIG
Template Known Secondary structure  B
BTSS


TT

SSS
TTS
TTS
Template Predicted Secondary structure 





























   265....270.........280.........290.... .....300.........310.
Predicted Secondary structure 














......








Query Sequence  PFDSYVLDFVAGEGVGKGNWAFHCQSQEHM. . . . . . MNGMFGIFMVEEGKRVN
Query Conservation 



 

 
 


   

 






  
 ......  



 
 


     
Alig confidence 












...













......
















Template Conservation   
           ... 
                    
              
Template Sequence  PGERYDVILNMDN. . . PGLWMIHDHVDTHTTNGDKPDGGIMTTIEYEEVGIDH
Template Known Secondary structure  TT


S...
SSSGGGS
BTTBSS
BSTTT
S

Template Predicted Secondary structure 





...



















Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions