Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence98.12%DateWed Nov 27 10:15:14 GMT 2024
Rank139Aligned Residues100
% Identity27%Templatec2p0bA_
PDB info PDB header: electron transportChain: A: PDB Molecule: cytochrome c-type protein nrfb; PDBTitle: crystal structure of chemically-reduced e.coli nrfb
PDB Entry: PDBe RCSB PDBj
Resolution1.74 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   402..... ..410.........420.........430.........440.........450.........460
Predicted Secondary structure 


.

































Query Sequence  RPDQCV. ECHEETTPGIVAEWKMSNHANPKKNPHVSAETQEIEALIGKELNNWRPGTKDG
Query Conservation      

. 

   




 

  
 

                                 
Alig confidence 





.






.....







.......................









Template Conservation      
   

    .....        .......................          
Template Sequence  PDAACLDDCHKPDT. . . . . EGMHGKHA. . . . . . . . . . . . . . . . . . . . . . . SVINPNNKLP
Template Known Secondary structure  TT.TS
TTT.....SS

SGGG.......................G
B
TTTSSB
Template Predicted Secondary structure 







.....





.......................









   461........ 470.........480 ......... 490........
Predicted Secondary structure 




.................









.

....
Query Sequence  VYCSYCHGS. . . . . . . . . . . . . . . . . DHEKLFMPTVD. NSCGACHPK. . . . QAAEFIKGR
Query Conservation 
 
  

  ................. 
         .  
  

  ....
  
     
Alig confidence 








.................










.








....








Template Conservation    
  

                                 
  

               
Template Sequence  VTCTNCHGQQPSPQHREEGVKDVMRFNEPMYKVGEQNSSVCMSCHLPEEQLQKAFWPHDV
Template Known Secondary structure 

T

.

TTGGG.

SSS

SSSTTS
.TTT

.
TT
Template Predicted Secondary structure 

















































   499500.........510.........520.........530.........540........ .550
Predicted Secondary structure 





























........

Query Sequence  DHGRPNHPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCHQNMSSCDDCHS. . . . . . . . RH
Query Conservation                   
               

  



 
 
 



........

Alig confidence 



......................................







........

Template Conservation 
   ......................................  
  

           
Template Sequence  HVTK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . VACASCHSSLHPQQQDTT
Template Known Secondary structure  TT......................................S


.
SSSS.
G.
Template Predicted Secondary structure 



......................................













   551...... ..560.......
Predicted Secondary structure 



.




Query Sequence  RFSAAEA. RRPEACSICH
Query Conservation   

  

.


 

  

Alig confidence 






.









Template Conservation               
  

Template Sequence  MQTLSDKKGRIKICVDCH
Template Known Secondary structure  GGG

TT.
Template Predicted Secondary structure 











Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions