Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence100.00%DateWed Nov 27 10:15:14 GMT 2024
Rank67Aligned Residues260
% Identity21%Templatec2q9oA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: laccase-1; PDBTitle: near-atomic resolution structure of a melanocarpus albomyces laccase
PDB Entry: PDBe RCSB PDBj
Resolution1.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.... .. ...60.........70.........80.........90
Predicted Secondary structure 







.

.















Query Sequence  TGKDGAVHLEMEAKPLTIEPRP. GV. FFDAWGYCLKGDVPTVPGPVIKVREGTKVKILFR
Query Conservation           
  
     
  
.

.    

 



   








 




 
 
 
Alig confidence 





















.

.









.....


















Template Conservation                                   

 ..... 


 
    

   
   
Template Sequence  PDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGN. . . . . IMGPNIVANWGDTVEVTVI
Template Known Secondary structure 





TTS.TTB.....SS


TT
Template Predicted Secondary structure 














.....








   91... .....100.........110.........120..... ....130.........140........
Predicted Secondary structure 


.
























.












Query Sequence  NKLT. VPASIHPHGVKYTTANVGVNIAGNPASIVAP. GDSRIFEWDTAGTPGTWFYHSYV
Query Conservation 
 
 .









  
   


   
 

  
 
.





 
 

  









Alig confidence 



.









.



















.







.













Template Conservation 
 
       
 

 .       

        
 
 
    
  .     

  

 
 
Template Sequence  NNLVTNGTSIHWHGI. QKDTNLHDGANGVTECPIPPKGGQRTYRW. RARQYGTSWYHSHF
Template Known Secondary structure 
SS

B
T
.
TT
GGGS

BTTTB..B.TTT.

S

S
Template Predicted Secondary structure 







.


















.









   149150.........160.........170.........180.........190.........200.... .
Predicted Secondary structure 


































...
Query Sequence  FERGGEEGLSRGLWGALIVEPVGGDPNPPDKEFVVFMHAFNVNGQEYYAFNNKSGD. . . I
Query Conservation        


  

 
 




        


 



 
 
  

     
    
... 
Alig confidence  .....
























.
























...
Template Conservation  .....  
   

 
  

           .       
                     
Template Sequence  . . . . . SAQYGNGVVGTIQINGPASLPYDID. LGVFPITDYYYRAADDLVHFTQNNAPPFS
Template Known Secondary structure  .....TTGGGGT



SS

S.
SS
TTS....B
Template Predicted Secondary structure  .....
















.












   206...210..... ....220.........230.....
Predicted Secondary structure 




.......







.......................
Query Sequence  ELMRGDSSAF. . . . . . . PGETWKAKMGDKVRFHLINI. . . . . . . . . . . . . . . . . . . . . . .
Query Conservation     



   .......
  

 
  

 






 .......................
Alig confidence 









.......



















.......................
Template Conservation     



                   
   


 

                 

  

 
Template Sequence  DNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMV
Template Known Secondary structure  STTB
B
TTT

B


.TT


SS

TTB
TT
Template Predicted Secondary structure 






























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation     
       
  
 
 

 
                                      
Template Sequence  PVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGA
Template Known Secondary structure  S

TT


S
SS

GGGTT

BSSS

TTS
Template Predicted Secondary structure 




























  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                              
Template Sequence  PGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKV
Template Known Secondary structure 

S






...

TT


S


BSS

B


TT



GGG
SSSSS
Template Predicted Secondary structure 















































   236...240....
Predicted Secondary structure  ...................................................





Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . TEEAHTFHT
Query Conservation  ...................................................
   




Alig confidence  ...................................................








Template Conservation 
                                            
         

 

Template Sequence  NGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHL
Template Known Secondary structure  TTB




TTS
T




GGG


SS

TTSS



Template Predicted Secondary structure 












































   245....250....... ..260.........270.......
Predicted Secondary structure 







...........................






Query Sequence  HGHRWLDKSCDKL. . . . . . . . . . . . . . . . . . . . . . . . . . . IDTIGLNPFDSYVLDFVAGE
Query Conservation 


 
 

     ...........................



 
 



 

 
 


Alig confidence 












...........................



















Template Conservation 

  
 
                                  

  
       
      
Template Sequence  HGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDN
Template Known Secondary structure  SSS.S..

TTS






GGG


BS

S
TTS

S
Template Predicted Secondary structure 






































   278.280.........290.........300........
Predicted Secondary structure 














Query Sequence  GVGKGNWAFHCQSQEHMMNGMFGIFMVEEGK
Query Conservation     

 






  
   



 
 


  
Alig confidence  ...



























Template Conservation  ... 
 
  


   
   

          
Template Sequence  . . . PGAWLFHCHIAWHVSGGLSVDFLERPAD
Template Known Secondary structure  ...


TT

Template Predicted Secondary structure  ...






Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions