Return to main results Retrieve Phyre Job Id

Job DescriptionSwiss-Prot_entry_P0DV45_from_UniProt
Confidence99.73%DateWed Nov 27 10:15:14 GMT 2024
Rank114Aligned Residues228
% Identity20%Templatec3mmoA_
PDB info PDB header: oxidoreductaseChain: A: PDB Molecule: eight-heme nitrite reductase; PDBTitle: structure of the thioalkalivibrio nitratireducens cytochrome c nitrite2 reductase in complex with cyanide
PDB Entry: PDBe RCSB PDBj
Resolution1.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   398.400.........410.........420.........430.........440.........450.......
Predicted Secondary structure 


































Query Sequence  LVKYRPDQCVECHEETTPGIVAEWKMSNHANPKKNPHVSAETQEIEALIGKELNNWRPGT
Query Conservation          

 

   




 

  
 

                              
Alig confidence 














....










..............................
Template Conservation          
  

  ....           ..............................
Template Sequence  LKPVDAMQCFDCHTQ. . . . IEDMHTVGKHA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure 




TT
....TTSTTT..............................
Template Predicted Secondary structure 






....




..............................
   458.460.........470 .........480.........490...... ...500.
Predicted Secondary structure 








...........










.
....
Query Sequence  KDGVYCSYCHGSD. . . . . . . . . . . HEKLFMPTVDNSCGACHPKQAAEFIK. GRDHG. . . .
Query Conservation     
 
  

   ...........
           
  

  
  
   .     ....
Alig confidence  ..










...........

























.




....
Template Conservation  ..   
  

                          
  

                   
Template Sequence  . . TVNCVHCHDATEHVETASSRRMGERPVTRMDLEACATCHTAQFNSFVEVRHESHPRLE
Template Known Secondary structure  ..TS
GGGT

BTTB

S..


TTT



TTS
SS
B
Template Predicted Secondary structure  ..








































  
Predicted Secondary structure  ............................................................
Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ............................................................
Template Conservation                                                              
Template Sequence  KATPTSRSPMFDKLIAGHGFAFEHAEPRSHAFMLVDHFVVDRAYGGRFQFKNWQKVTDGM
Template Known Secondary structure  SSSTTSS
TTTTSGGGG

B..

GGGSTTTSTT
SSGGGGG
Template Predicted Secondary structure 































   502.......510.........520.........530.........540.
Predicted Secondary structure  ...





















.................
Query Sequence  . . . RPNHPQSWEGNVSTPWYAEYYRRGEGYSMVGCDQCHQNMS. . . . . . . . . . . . . . . . .
Query Conservation  ...              
               

  



 
.................
Alig confidence  ...







































.................
Template Conservation                                    
  

                     
Template Sequence  GAVRGAWTVLTDADPESSDQRRFLSQTATAANPVCLNCKTQDHILDWAYMGDEHEAAKWS
Template Known Secondary structure 
GGGTS
TT

S


SSTT





TTT

TTTTSB
GGG


TT
SB
Template Predicted Secondary structure 


















































   542.......550........
Predicted Secondary structure  ................













...........................
Query Sequence  . . . . . . . . . . . . . . . . SCDDCHSRHRFSAAEAR. . . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ................ 
 





 

  


...........................
Alig confidence  ................
















...........................
Template Conservation                   
  

                                      
Template Sequence  RTSEVVEFARDLNHPLNCFMCHDPHSAGPRVVRDGLINAVVDRGLGTYPHDPVKSEQQGM
Template Known Secondary structure  TTS
T


SS
GGGTB
TTT

B






T


SSTT
T
Template Predicted Secondary structure 







































   559560 .........570
Predicted Secondary structure  ......
................





..........................
Query Sequence  . . . . . . RP. . . . . . . . . . . . . . . . EACSICHMGP. . . . . . . . . . . . . . . . . . . . . . . . . .
Query Conservation  ......

................ 

  




..........................
Alig confidence  ......

................









..........................
Template Conservation                            
  

                             
Template Sequence  TKVTFQRGREDFRAIGLLDTADSNVMCAQCHVEYNCNPGYQLSDGSRVGMDDRRANHFFW
Template Known Secondary structure  TTSS

TTTSS
S

TTT


TTSGGG

Template Predicted Secondary structure 

















































   571........580.........590.........600
Predicted Secondary structure  ..............................


















Query Sequence  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DHPDWESYSRSKWGVIYETTKERWNWDKNL
Query Conservation  ..............................



 


  



 

       
     
Alig confidence  ..............................















..............
Template Conservation                                            
   ..............
Template Sequence  ANVFDYKEAAQEIDFFDFRHATTGAALPKLQHPEAETFWGSVHERN. . . . . . . . . . . . . .
Template Known Secondary structure 

TTTTT
B

TTT







TTST..............
Template Predicted Secondary structure 





























..............
   601........610.........620.........630.........640.........650.........660
Predicted Secondary structure 


















































Query Sequence  AEVIPGEDYLAPTCQYCHMYVGNNKWEMNVETKGIWRMGVIPPKEVEFKSGLKDFPYGIK
Query Conservation    
  
 

 








  
    



  
  
                   
    
Alig confidence  ..........
























.........................
Template Conservation  ..........   
  

                 .........................
Template Sequence  . . . . . . . . . . GVACADCHMPKVQLENGKVYTSHSQ. . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure  ..........T

S.B.

SSS


B



.........................
Template Predicted Secondary structure  ..........
























.........................
   661........670.........680.........690.........700.........710.........720
Predicted Secondary structure 













Query Sequence  IPPMDKKLEIYSAESQEKRRKWVELCSKCHSSRFAGMWLDSLDQYMFESWRRIDEAQLII
Query Conservation               
    
  
  

  


  

       
  
 
      

   
Alig confidence  ...............












































Template Conservation  ...............          
  

                              
Template Sequence  . . . . . . . . . . . . . . . RTPRDMMGQACLNCHAEWTEDQALYAIDYIKNYTHGKIVKSEYWL
Template Known Secondary structure  ...............

GGGS




TT
TT

Template Predicted Secondary structure  ...............














   721....
Predicted Secondary structure 
Query Sequence  EKLFS
Query Conservation    
  
Alig confidence 




Template Conservation       
Template Sequence  AKMID
Template Known Secondary structure 
Template Predicted Secondary structure 
Download:Text version FASTA version

No model constructed - rank, confidence too low


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group,
Imperial College,
London
Michael Sternberg

Disclaimer

Terms and Conditions