Return to main results Retrieve Phyre Job Id

Job DescriptionDangers_of_Intensive
Confidence98.74%DateSun Sep 7 17:29:03 BST 2014
Rank19Aligned Residues42
% Identity62%Templatec3ngbI_
PDB info PDB header:viral protein/immune systemChain: I: PDB Molecule:envelope glycoprotein gp160; PDBTitle: crystal structure of broadly and potently neutralizing antibody vrc012 in complex with hiv-1 gp120
Resolution2.68 Å
Model Dimensions (Å)X:38.770 Y:43.792 Z:27.310

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   226...230.........240.........250.........260.........270.........280.....
Predicted Secondary structure 

























Query SS confidence 



























































Query Sequence  AKEAAVQLNTSVQINCTRPNYNKRKRIHIGRGPGRAFYTTGKIGNMRQAHCNISRAKWNN
Query Conservation 

   

 
 
  
   
               
         
  
          
  
Alig confidence 






















....................
















Template Conservation 

 


 

  
 


 





....................





 
 
 

 
  
Template Sequence  AKTIIVHLNKSVEINCTRPSNGG. . . . . . . . . . . . . . . . . . . . GDIRKAYCEINGTKWNK
Template Known Secondary structure  TS





....................

SS
Template Predicted Secondary structure 









....................


Template SS confidence 



























































   281........290.........300... ......310.........320
 
   286.
Predicted Secondary structure 

Query SS confidence 

Query Sequence  TL
Query Conservation    
Alig confidence 

Template Conservation   
Template Sequence  VL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   341.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in JSmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D