Return to main results Retrieve Phyre Job Id

Job DescriptionDangers_of_Intensive
Confidence96.82%DateSun Sep 7 17:29:03 BST 2014
Rank25Aligned Residues32
% Identity84%Templatec3rjqA_
PDB info PDB header:viral protein/immune systemChain: A: PDB Molecule:c186 gp120; PDBTitle: crystal structure of anti-hiv llama vhh antibody a12 in complex with2 c186 gp120
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   226...230.........240.........250.........260.........270.........280.....
Predicted Secondary structure 

























Query SS confidence 



























































Query Sequence  AKEAAVQLNTSVQINCTRPNYNKRKRIHIGRGPGRAFYTTGKIGNMRQAHCNISRAKWNN
Query Conservation 

   

 
 
  
   
               
         
  
          
  
Alig confidence 

















..............................











Template Conservation 





 

 

 




..............................
 





 
  
Template Sequence  AKTIIVHLNESVNIVCTR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AHCNINESKWNN
Template Known Secondary structure  TS
B
..............................

Template Predicted Secondary structure 




..............................


Template SS confidence 



























































   281........290........ .300.........310
 
   286.
Predicted Secondary structure 

Query SS confidence 

Query Sequence  TL
Query Conservation    
Alig confidence 

Template Conservation 

Template Sequence  TL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   341.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D