Return to main results Retrieve Phyre Job Id

Job DescriptionQ965N4
Confidence21.24%DateFri May 3 21:39:00 BST 2013
Rank234Aligned Residues25
% Identity36%Templatec3u5pF_
PDB info PDB header:transcriptionChain: F: PDB Molecule:e3 ubiquitin-protein ligase trim33; PDBTitle: crystal structure of the complex of trim33 phd-bromo and h3(1-28)2 k9me3k14ack18ack23ac histone peptide
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200.........210...
Predicted Secondary structure 







Query SS confidence 





























Query Sequence  YCDYCRNFLWGLVHQGMRCEDCGFAAHKKC
Query Conservation   
  
   


    
  
  
    

 
Alig confidence 






...
..
















Template Conservation   
 

  ... ..
 

 

 
   

  
Template Sequence  WCAVCQN. . . G. . GDLLCCEKCPKVFHLTC
Template Known Secondary structure  SBTTT

...
..SS

SSSS

TTT
Template Predicted Secondary structure 



...
..





Template SS confidence 





























   889890..... . ...900.........910...
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D