Return to main results Retrieve Phyre Job Id

Job DescriptionQ20196
Confidence5.97%DateFri May 3 21:41:44 BST 2013
Rank19Aligned Residues24
% Identity50%Templatec3i0uA_
PDB info PDB header:lyaseChain: A: PDB Molecule:phosphothreonine lyase ospf; PDBTitle: structure of the type iii effector/phosphothreonine lyase ospf from2 shigella flexneri
Resolution2.70 Å
Model Dimensions (Å)X: Y: Z:

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118.120.........130.........140.........150.......
Predicted Secondary structure 























Query SS confidence 







































Query Sequence  WFATDTLCDNDRSIEQRGQPVHVSVSSILPSKFGLLVKSV
Query Conservation 
 








 
 

  
 
 





 

 
 
 



Alig confidence 








................














Template Conservation 





  
................

  






 


Template Sequence  WKITDMNRV. . . . . . . . . . . . . . . . SVGIGAQFTLYVKSD
Template Known Secondary structure 
TTT
................


SS



Template Predicted Secondary structure 


................





Template SS confidence 







































   133......140. ........150......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D