Return to main results Retrieve Phyre Job Id

Job DescriptionQ20196
Confidence2.14%DateFri May 3 21:41:44 BST 2013
Rank89Aligned Residues55
% Identity24%Templatec3kbgA_
PDB info PDB header:ribosomal proteinChain: A: PDB Molecule:30s ribosomal protein s4e; PDBTitle: crystal structure of the 30s ribosomal protein s4e from2 thermoplasma acidophilum. northeast structural genomics3 consortium target tar28.
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.........90.........100.........110.........120.
Predicted Secondary structure 





























Query SS confidence 










































































Query Sequence  YRVVVDTKNPVKIIISKIMFVYLQPPAIRVSVASENASLKHILAVTVVRGKTVHNIALSRLQSHRNKQYEYWFAT
Query Conservation    
 

  

  

     
   








 
  
 

 


 
 







 

 
 

   
   

 

Alig confidence 








................














....






























Template Conservation 



 
  
................ 
 
  
  


  
....
 

  
  



  

  





      
Template Sequence  YRVVYNDQG. . . . . . . . . . . . . . . . ALVLXKETKERASXK. . . . LLKVRSKVIAPGNRIQLGTHDGRTFITDDKS
Template Known Secondary structure 
TTS................


TTGGG....GGGTTS


TT
Template Predicted Secondary structure 



................




....










Template SS confidence 










































































   93......100. ........110...... ...120.........130.........140.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D