Return to main results Retrieve Phyre Job Id

Job DescriptionQ20646
Confidence12.00%DateFri May 3 21:47:31 BST 2013
Rank81Aligned Residues57
% Identity16%Templatec3lvgD_
PDB info PDB header:structural proteinChain: D: PDB Molecule:clathrin light chain b; PDBTitle: crystal structure of a clathrin heavy chain and clathrin light chain2 complex
Resolution7.94 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   141........150.........160.........170.........180.........190.........200.........210.........220
Predicted Secondary structure 

























Query SS confidence 















































































Query Sequence  EEEQQLVIEKRARERFIRKSMKIAEETALSYENDGSRELSETMTQKVTQMDFTETNVPFDGNDESSNLAVRVQSDMNLNE
Query Conservation   


      
  

 


  
   
 










 

  
 
     






             
  
    
Alig confidence 



























.........













.....................







Template Conservation 



























.........













.....................



 


Template Sequence  REEQRKRLQELDAASKVMEQEWREKAKK. . . . . . . . . DLEEWNQRQSEQVE. . . . . . . . . . . . . . . . . . . . . KNKINNRI
Template Known Secondary structure  TTTST..............................TT
S
Template Predicted Secondary structure  ..............................
Template SS confidence 















































































   106...110.........120.........130... ......140....... ..150.....
 
   221......
Predicted Secondary structure 
Query SS confidence 






Query Sequence  DCEKWME
Query Conservation    
 

 
Alig confidence 






Template Conservation 


 


Template Sequence  ADKAFYQ
Template Known Secondary structure  STTTSS
Template Predicted Secondary structure 
Template SS confidence 






   156...160..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D