Return to main results Retrieve Phyre Job Id

Job DescriptionQ21408
Confidence21.01%DateSat Apr 13 12:50:02 BST 2013
Rank401Aligned Residues24
% Identity21%Templated1vlpa1
SCOP infoalpha/beta-Hammerhead Nicotinate/Quinolinate PRTase N-terminal domain-like Monomeric nicotinate phosphoribosyltransferase N-terminal domain-like
Resolution1.75

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2391........2400.........2410.........2420..
Predicted Secondary structure 



















Query SS confidence 































Query Sequence  NLTPEQAEFCIRRMKPYMDAISGRSIQGGLDY
Query Conservation                                  
Alig confidence 














........








Template Conservation 


 


 

     ........     

 
Template Sequence  RFTEEEIEYLKQEIP. . . . . . . . YLPSAYIKY
Template Known Secondary structure 



T........TS
Template Predicted Secondary structure 




........


Template SS confidence 































   64.....70........ .80.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D