Return to main results Retrieve Phyre Job Id

Job DescriptionQ21408
Confidence21.98%DateSat Apr 13 12:50:02 BST 2013
Rank393Aligned Residues37
% Identity27%Templatec4fbdB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:putative uncharacterized protein; PDBTitle: 2.35 angstrom crystal structure of conserved hypothetical protein from2 toxoplasma gondii me49.
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2290.........2300.........2310.........2320.........2330.........2340.........2350....
Predicted Secondary structure 


























Query SS confidence 
































































Query Sequence  MFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAFM
Query Conservation   
   
                                                           
Alig confidence 






.....................

.......



























Template Conservation 
 



 .....................  .......
 

   


 
       
  





Template Sequence  CYRQFDD. . . . . . . . . . . . . . . . . . . . . VT. . . . . . . KEEFLEKVNELVTRDAGIEFFQGYAPFC
Template Known Secondary structure  TS

.....................

.......SSTT


SSTT
Template Predicted Secondary structure 
.....................

.......











Template SS confidence 
































































   28.30.... .. ...40.........50.........60....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D