Return to main results Retrieve Phyre Job Id

Job DescriptionQ21408
Confidence23.35%DateSat Apr 13 12:50:02 BST 2013
Rank378Aligned Residues34
% Identity29%Templatec3l9qB_
PDB info PDB header:transferaseChain: B: PDB Molecule:dna primase large subunit; PDBTitle: crystal structure of human polymerase alpha-primase p58 iron-sulfur2 cluster domain
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2291........2300.........2310.........2320.........2330.........2340.
Predicted Secondary structure 





















Query SS confidence 


















































Query Sequence  FKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNR
Query Conservation 
   
                                              
Alig confidence 






........









..

.......














Template Conservation 

     ........ 
   
   
..
 .......   
  
        
Template Sequence  FRHSDPE. . . . . . . . LLKQKLQSYK. . IS. . . . . . . PGGISQILDLVKGTH
Template Known Secondary structure  S
........TT..

.......TT
Template Predicted Secondary structure 




........

..

.......


Template SS confidence 


















































   386...390.. .......400.. .. .....410.........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D