Return to main results Retrieve Phyre Job Id

Job DescriptionQ21408
Confidence27.49%DateSat Apr 13 12:50:02 BST 2013
Rank352Aligned Residues43
% Identity12%Templatec3bunB_
PDB info PDB header:ligase/signaling proteinChain: B: PDB Molecule:e3 ubiquitin-protein ligase cbl; PDBTitle: crystal structure of c-cbl-tkb domain complexed with its2 binding motif in sprouty4
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2287..2290.........2300.........2310.........2320.........2330.........2340.........2350...
Predicted Secondary structure 


























Query SS confidence 


































































Query Sequence  FSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYVTLQEYMAF
Query Conservation      
   
                                                          
Alig confidence 











..













......................
















Template Conservation 
  
   
   
..   
  
  


 
......................

 
    








Template Sequence  WKSFRQALHEVH. . PISSGLEAMALKST. . . . . . . . . . . . . . . . . . . . . . IDLTCNDYISVFEFDIF
Template Known Secondary structure  S..



......................
TT
SS
Template Predicted Secondary structure 
..




......................





Template SS confidence 


































































   202.......210... ......220....... ..230.........240....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D