Return to main results Retrieve Phyre Job Id

Job DescriptionP0A084
Confidence88.75%DateTue Jul 17 17:05:04 BST 2012
Rank36Aligned Residues44
% Identity11%Templated1mwza_
SCOP infoFerredoxin-like HMA, heavy metal-associated domain HMA, heavy metal-associated domain
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.........60.........70....
Predicted Secondary structure 

























Query SS confidence 
































































Query Sequence  GGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEI
Query Conservation 




  
  
  
 

  
  




    


  
  
 


 
 
 
 


  

   

  
Alig confidence 
























...................












..





Template Conservation    
   

  
    

  
 

  ...................   
 
       ..  
   
Template Sequence  AACARKVENAVRQLAGVNQVQVLFA. . . . . . . . . . . . . . . . . . . TEKLVVDADNDIR. . AQVESA
Template Known Secondary structure  TSSSTT...................TTSS

..
Template Predicted Secondary structure 




...................





..
Template SS confidence 
































































   16...20.........30.........40 .........50... ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions