Return to main results Retrieve Phyre Job Id

Job DescriptionP0A086
Confidence14.67%DateTue Jul 17 17:05:04 BST 2012
Rank78Aligned Residues26
% Identity15%Templated1kgsa1
SCOP infoDNA/RNA-binding 3-helical bundle C-terminal effector domain of the bipartite response regulators PhoB-like
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   146...150.........160.........170.......
Predicted Secondary structure 













Query SS confidence 































Query Sequence  DYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA
Query Conservation   

 
 
  
        
       
     
Alig confidence 











......













Template Conservation    
      


......
  
   

     
Template Sequence  EYLVXNKNRVVT. . . . . . KEELQEHLWVFSDV
Template Known Secondary structure  TTTS
......


Template Predicted Secondary structure 




......






Template SS confidence 































   161........170.. .......180......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions