Return to main results Retrieve Phyre Job Id

Job DescriptionP0A086
Confidence73.08%DateTue Jul 17 17:05:04 BST 2012
Rank40Aligned Residues45
% Identity11%Templatec2k2pA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein atu1203; PDBTitle: solution nmr structure of protein atu1203 from agrobacterium2 tumefaciens. northeast structural genomics consortium (nesg) target3 att10, ontario center for structural proteomics target atc1183
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.........60.........70...
Predicted Secondary structure 

























Query SS confidence 































































Query Sequence  GGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILD
Query Conservation 





 
  
  
 

  
  




    


  

 
 


 
 
 
 


  

   

 
Alig confidence 


























...................

















Template Conservation    
   
  

    

  
 
     ................... 
 
        
   
 
Template Sequence  GHCAGVIKGAIEKTVPGAAVHADPASR. . . . . . . . . . . . . . . . . . . TVVVGGVSDAAHIAEIIT
Template Known Secondary structure  STT
TTTT...................S


Template Predicted Secondary structure 





...................


Template SS confidence 































































   34.....40.........50.........60 .........70........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions